Rabbit Polyclonal Anti-PSG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSG1 antibody: synthetic peptide directed towards the C terminal of human PSG1. Synthetic peptide located within the following region: YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA |
Rabbit Polyclonal Anti-SMR3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMR3A antibody: synthetic peptide directed towards the middle region of human SMR3A. Synthetic peptide located within the following region: YGPGRIPPSPPPPYGPGRIQSHSLPPPYGPGYPQPPSQPRPYPPGPPFFP |
Rabbit Polyclonal Anti-GNLY Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNLY antibody: synthetic peptide directed towards the n terminal of human GNLY. Synthetic peptide located within the following region: TRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIPSTG |
Rabbit Polyclonal Anti-TAC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAC3 antibody: synthetic peptide directed towards the middle region of human TAC3. Synthetic peptide located within the following region: RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF |
Rabbit Polyclonal Anti-FETUB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FETUB antibody: synthetic peptide directed towards the N terminal of human FETUB. Synthetic peptide located within the following region: GCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYL |
Rabbit Polyclonal Anti-RNASE9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNASE9 antibody: synthetic peptide directed towards the N terminal of human RNASE9. Synthetic peptide located within the following region: PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNH |
Rabbit Polyclonal Anti-LIPF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LIPF antibody: synthetic peptide directed towards the N terminal of human LIPF. Synthetic peptide located within the following region: ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH |
Rabbit Polyclonal Anti-SPARCL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPARCL1 antibody is: synthetic peptide directed towards the N-terminal region of Human SPARCL1. Synthetic peptide located within the following region: QESITKREENQEQPRNYSHHQLNRSSKHSQGLRDQGNQEQDPNISNGEEE |
Rabbit Polyclonal Anti-ACP6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP6 antibody: synthetic peptide directed towards the N terminal of human ACP6. Synthetic peptide located within the following region: EADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVEWNPQLLEVPP |
Rabbit Polyclonal Anti-ACP6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP6 antibody: synthetic peptide directed towards the N terminal of human ACP6. Synthetic peptide located within the following region: EQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGMFA |
Rabbit Polyclonal Anti-LAMB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAMB1 antibody: synthetic peptide directed towards the middle region of human LAMB1. Synthetic peptide located within the following region: VEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENL |
Rabbit Polyclonal Anti-NID2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NID2 antibody: synthetic peptide directed towards the middle region of human NID2. Synthetic peptide located within the following region: DDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMV |
Germany
Japan
United Kingdom
China