Rabbit Polyclonal Anti-SETDB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SETDB2 antibody: synthetic peptide directed towards the N terminal of human SETDB2. Synthetic peptide located within the following region: ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKE |
Rabbit Polyclonal Anti-NSUN5C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NSUN5C antibody: synthetic peptide directed towards the middle region of human NSUN5C. Synthetic peptide located within the following region: PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA |
Rabbit Polyclonal Anti-PHACS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHACS antibody: synthetic peptide directed towards the middle region of human PHACS. Synthetic peptide located within the following region: RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC |
Rabbit Polyclonal Anti-C3orf39 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C3orf39 antibody: synthetic peptide directed towards the N terminal of human C3orf39. Synthetic peptide located within the following region: MHLSAVFNALLVSVLAAVLWKHVRLREHAATLEEELALSRQATEPAPALR |
Rabbit Polyclonal Anti-C3orf39 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C3orf39 antibody: synthetic peptide directed towards the middle region of human C3orf39. Synthetic peptide located within the following region: TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN |
Rabbit Polyclonal Anti-ALG2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALG2 antibody: synthetic peptide directed towards the C terminal of human ALG2. Synthetic peptide located within the following region: QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC |
Rabbit Polyclonal Anti-NEK9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEK9 antibody: synthetic peptide directed towards the middle region of human NEK9. Synthetic peptide located within the following region: GGGGGGEEEDSQQESETPDPSGGFRGTMEADRGMEGLISPTEAMGNSNGA |
Rabbit Polyclonal Anti-PCMTD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCMTD1 antibody: synthetic peptide directed towards the middle region of human PCMTD1. Synthetic peptide located within the following region: TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIY |
Rabbit Polyclonal Anti-TGM7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGM7 antibody: synthetic peptide directed towards the C terminal of human TGM7. Synthetic peptide located within the following region: TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVE |
Rabbit Polyclonal Anti-MATN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MATN1 antibody: synthetic peptide directed towards the middle region of human MATN1. Synthetic peptide located within the following region: KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA |
Rabbit Polyclonal Anti-INMT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INMT antibody: synthetic peptide directed towards the N terminal of human INMT. Synthetic peptide located within the following region: KGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGP |
Rabbit Polyclonal Anti-LIAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LIAS antibody: synthetic peptide directed towards the N terminal of human LIAS. Synthetic peptide located within the following region: LLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMG |
Rabbit Polyclonal Anti-ECHDC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ECHDC2 antibody: synthetic peptide directed towards the middle region of human ECHDC2. Synthetic peptide located within the following region: FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI |
Rabbit Polyclonal Anti-TRMT5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRMT5 antibody: synthetic peptide directed towards the middle region of human TRMT5. Synthetic peptide located within the following region: EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT |
KIF3B rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Canine, Chicken, Human, Mouse, Rat |
| Immunogen | The immunogen for anti-KIF3B antibody: synthetic peptide directed towards the C terminal of human KIF3B |
TSPAN17 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish |
| Immunogen | Synthetic peptide corresponding to the middle region of human TSPAN17 |
Avil rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Guinea Pig, Mouse, Rabbit, Rat |
| Immunogen | Synthetic peptide directed towards the N-term region of rat AVIL |
RGS20 (isoform 6 specific) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-RGS20 antibody: synthetic peptide directed towards the N terminal of human RGS20 |
ZNF237 (ZMYM5) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Human |
| Immunogen | The immunogen for anti-ZNF237 antibody: synthetic peptide directed towards the N terminal of human ZNF237 |
Angiomotin like 1 (AMOTL1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse |
| Immunogen | Synthetic peptide directed towards the N terminal of human AMOTL1 |
AOC2 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog |
| Immunogen | Synthetic peptide directed towards the middle region of human AOC2 |
ALG2 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, African clawed frog |
| Immunogen | Synthetic peptide directed towards the C terminal of human ALG2 |
ac rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Drosophila |
| Immunogen | Synthetic peptide corresponding to N-term region of Fruit fly |
Aste1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | Synthetic peptide directed towards the middle region of mouse ASTE1 |
ACAA2 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Porcine, Rat, African clawed frog |
| Immunogen | Synthetic peptide directed towards the N terminal of human ACAA2 |
Archaemetzincin 2 (AMZ2) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide directed towards an internal region of rat AMZ2 |
NRBF2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide directed towards the N terminal of human NRBF2 |
Cop1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to a middle region of mouse |
HERC4 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Rat, African clawed frog |
| Immunogen | Synthetic peptide corresponding to the N terminal region of human HERC4, Isoform 5 |
Slc22a3 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide directed towards the middle region of mouse Slc22a3 |
Fndc9 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to the N-terminalregionof mouse FNDC9 |
Ssr2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to a C-terminal region of mouse SSR2 |
Scara3 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to the middle region of mouse Scara3 |
Cyb5r1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to a region near N-terminus of mouse Cyb5r1 |
Tmco3 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to the middle region of mouse Tmco3 |
Fggy (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to a region near N-terminus of mouse Fggy, Isoform 2 |
Ccdc90b (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to the N-terminal region of mouse Ccdc90b |
Lacc1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to the C-terminal region of mouse Lacc1 / C13orf31 |
Rpia (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide directed towards the middle region of mouse Rpia |
ADAMTS6 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide directed towards the C terminal of human ADAMTS6 |
ALKBH1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide corresponding to a N-terminal region of human ALKBH1 |
ATXN10 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide directed towards the N-terminal region of human ATXN10 |
Germany
Japan
United Kingdom
China
