Rabbit Polyclonal Anti-ACP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP |
Rabbit Polyclonal Anti-MTMR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTMR1 antibody: synthetic peptide directed towards the C terminal of human MTMR1. Synthetic peptide located within the following region: KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY |
Rabbit Polyclonal Anti-ACP5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP5 antibody: synthetic peptide directed towards the N terminal of human ACP5. Synthetic peptide located within the following region: DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ |
Rabbit Polyclonal Anti-ACPP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACPP antibody: synthetic peptide directed towards the middle region of human ACPP. Synthetic peptide located within the following region: CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV |
Rabbit Polyclonal Anti-ACP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the middle region of human ACP1. Synthetic peptide located within the following region: NISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFA |
Rabbit Polyclonal Anti-ACP6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP6 antibody: synthetic peptide directed towards the N terminal of human ACP6. Synthetic peptide located within the following region: EADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVEWNPQLLEVPP |
Rabbit Polyclonal Anti-ACP6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP6 antibody: synthetic peptide directed towards the N terminal of human ACP6. Synthetic peptide located within the following region: EQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGMFA |
Germany
Japan
United Kingdom
China
