Primary Antibodies

View as table Download

CAD rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAD

Rabbit polyclonal CAD (Thr456) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CAD around the phosphorylation site of threonine 456 (P-I-TP-P-H).
Modifications Phospho-specific

CAD 1625-1900 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1625 and 1900 of Human CAD

CAD (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 787-816 amino acids from the Central region of human CAD

Rabbit polyclonal antibody to CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1625 and 1930 of CAD (Uniprot ID#P27708)

Rabbit Polyclonal Anti-CAD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAD antibody: synthetic peptide directed towards the N terminal of human CAD. Synthetic peptide located within the following region: AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV

Rabbit polyclonal anti-CAD antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CAD.

Rabbit Polyclonal Anti-CAD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAD antibody: synthetic peptide directed towards the C terminal of human CAD. Synthetic peptide located within the following region: ADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREEL

cad Antibody - middle region

Applications WB
Reactivities Fruit fly
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a region of Fruit fly

CAD rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAD

CAD Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1650-1900 of human CAD (NP_004332.2).
Modifications Unmodified

Rabbit Polyclonal anti-CAD Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CAD

Rabbit Polyclonal anti-CAD Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CAD