Primary Antibodies

View as table Download

Rabbit anti-ALDH2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH2

Rabbit anti-AKR1A1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AKR1A1

Rabbit anti-LIPC Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human LIPC

Rabbit Polyclonal Anti-ALDH2 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Aldh2 antibody is synthetic peptide directed towards the C-terminal region of Mouse Aldh2. Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV

Rabbit Polyclonal Anti-PPAP2A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL

Rabbit Polyclonal Anti-ALDH1B1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH1B1 antibody: synthetic peptide directed towards the middle region of human ALDH1B1. Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL

Rabbit Polyclonal FALDH Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Antibody against DGKZ (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This DGKZ antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 989-1019 amino acids from the C-terminal region of human DGKZ.

AKR1B1 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AKR1B1

Rabbit Polyclonal Anti-DGKD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKD Antibody: A synthesized peptide derived from human DGKD

DGKD rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 34-88 of Human DGK-δ.

ALDH2 (N-term) rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2.

LIPC (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 310-338 amino acids from the Central region of Human LIPC / Hepatic lipase

Rabbit Polyclonal Antibody against ALDH2 (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2.

Rabbit polyclonal anti-GLPK antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human GLPK.

Rabbit polyclonal anti-DGKI antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human DGKI.

Rabbit polyclonal anti-DGKH antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKH.

Anti-PPAP2C rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 256-269 amino acids of Human phosphatidic acid phosphatase type 2C

Rabbit polyclonal AKR1B1 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This AKR1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 290-316 amino acids from the C-terminal region of human AKR1B1.

Rabbit Polyclonal Anti-ALDH7A1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH7A1 antibody: synthetic peptide directed towards the N terminal of human ALDH7A1. Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS

Rabbit Polyclonal Anti-PPAP2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLL

Rabbit Polyclonal Anti-AKR1B1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the N terminal of human AKR1B1. Synthetic peptide located within the following region: ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN

Rabbit Polyclonal Anti-AKR1B1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the C terminal of human AKR1B1. Synthetic peptide located within the following region: QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI

Rabbit Polyclonal Anti-LIPF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIPF antibody: synthetic peptide directed towards the N terminal of human LIPF. Synthetic peptide located within the following region: ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH

Rabbit Polyclonal Anti-DAK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-DAK Antibody: A synthesized peptide derived from human DAK

Rabbit Polyclonal Anti-GK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GK2 Antibody: A synthesized peptide derived from human GK2

Rabbit Polyclonal Anti-GK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GK Antibody: A synthesized peptide derived from human GK

DGKI rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Rat
Immunogen Synthetic peptide, corresponding to amino acids 1001-1050 of Human DGK-ι.

Galactosidase alpha (GLA) (N-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 90~120 amino acids from the N-terminal region of human GLA

Rabbit Polyclonal Antibody against ALDH2 (N-term)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2.

Rabbit polyclonal antibody to Pancreatic Lipase (pancreatic lipase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 21 and 300 of Pancreatic Lipase (Uniprot ID#P16233)

Rabbit Polyclonal antibody to Glycerol kinase 2 (glycerol kinase 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 67 and 338 of Glycerol kinase 2 (Uniprot ID#Q14410)

Rabbit polyclonal anti-DGKA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKA.

Rabbit polyclonal anti-Glycerol Kinase / GLPK3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GLPK3.

Rabbit polyclonal anti-DGKB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKB.

Rabbit polyclonal anti-ALDH1B1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ALDH1B1.

Rabbit polyclonal anti-AKR1B1 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AKR1B1.

Rabbit polyclonal anti-DGKQ antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKQ.

Rabbit polyclonal anti-GLPK2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GLPK2.

Rabbit polyclonal anti-DGKE antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKE.

Rabbit polyclonal anti-DAK antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DAK.

Anti-PPAP2C Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-269 amino acids of human phosphatidic acid phosphatase type 2C

Rabbit polyclonal AKR1A1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human AKR1A1.

Rabbit Polyclonal Anti-PNLIP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ

Rabbit Polyclonal Anti-GLA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GLA Antibody: synthetic peptide directed towards the N terminal of human GLA. Synthetic peptide located within the following region: PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF

Rabbit Polyclonal Anti-DGKH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: EPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQT

Rabbit Polyclonal Anti-ALDH1B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ALDH1B1

PPAP2C (PLPP2) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human, Porcine
Immunogen Synthetic peptide derived from the lipid phosphate phosphohydrolase 2 protein

Phosphatidic acid phosphatase type 2B (PLPP3) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide derived from the phosphatidic acid phosphatase 2B protein

AKR1A1 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human AKR1A1.