Primary Antibodies

View as table Download

Rabbit Polyclonal GLP-1R Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human GLP1R protein (between residues 250-350) [UniProt P43220]

Rabbit polyclonal anti-FSHR antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FSHR.

Rabbit anti-CGA Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CGA

Orexin Receptor 1 (HCRTR1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of human Orexin Receptor

FSH Receptor (FSHR) rabbit polyclonal antibody

Applications ELISA, IF, IHC
Reactivities Human
Immunogen Synthetic peptide from Human FSHR. (aa278-327)
Epitope: Internal

Rabbit polyclonal anti-HCRTR1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HCRTR1.

Rabbit polyclonal anti-FSHR antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FSHR.

Rabbit Polyclonal Anti-FSHR Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen FSH Receptor / FSHR antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human FSHR. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset (100%); Gibbon, Dog, Bat, Elephant, Rabbit, Horse, Pig, Guinea pig (94%); Bovine, Cat, Goat (88%); Mouse, Rat, Sheep (82%).

Orexin Receptor 1 (HCRTR1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 269-298 amino acids from the Central region of Human Orexin receptor type 1 (Center)

hCG (CGA) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 74-103 amino acids from the C-terminal region of human TSH-alpha

Rabbit polyclonal anti-GLP1R antibody

Applications IF
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GLP1R.

Orexin Receptor 1 / OX1R Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Human, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen OX1R / Orexin Receptor 1 antibody was raised against synthetic 14 amino acid peptide from 2nd extracellular domain of human HCRTR1 / Orexin Receptor 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Rabbit, Pig, Platypus (100%); Marmoset, Rat, Elephant, Panda, Dog, Bat, Horse (93%); Mouse, Hamster (86%).

Orexin Receptor 1 / OX1R Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey, Rat
Conjugation Unconjugated
Immunogen OX1R / Orexin Receptor 1 antibody was raised against synthetic 15 amino acid peptide from 3rd cytoplasmic domain of human HCRTR1 / Orexin Receptor 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Dog, Rabbit, Pig (93%); Mouse, Rat, Hamster, Elephant, Panda, Bovine, Bat (87%).

Orexin Receptor 1 / OX1R Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig
Immunogen OX1R / Orexin Receptor 1 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human HCRTR1 / Orexin Receptor 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Horse, Pig (100%); Elephant, Bovine (94%); Marmoset, Panda (88%); Bat (81%).

Rabbit Polyclonal Anti-HCRTR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HCRTR1 antibody is: synthetic peptide directed towards the N-terminal region of Human HCRTR1. Synthetic peptide located within the following region: ATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYV

Rabbit Polyclonal Anti-GLP1R Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen GLP1R/GLP-1R/GLP-1 Receptor antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human GLP1R. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Rat, Sheep, Bovine, Hamster, Elephant, Rabbit, Pig (94%).

Anti-HCRTR1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 393-405 amino acids of Human hypocretin (orexin) receptor 1

Anti-HCRTR1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 393-405 amino acids of Human hypocretin (orexin) receptor 1

Anti-GLP1R Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 24-145 amino acids of human glucagon-like peptide 1 receptor

Anti-FSHR Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 28-218 amino acids of human follicle stimulating hormone receptorfollicle stimulating hormone receptor

Anti-FSHR Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 28-218 amino acids of human follicle stimulating hormone receptor

Rabbit Polyclonal Anti-CGA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CGA

HCRTR1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated