Rabbit Polyclonal GLP-1R Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human GLP1R protein (between residues 250-350) [UniProt P43220] |
Rabbit Polyclonal GLP-1R Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human GLP1R protein (between residues 250-350) [UniProt P43220] |
Rabbit polyclonal anti-FSHR antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FSHR. |
Rabbit anti-CGA Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CGA |
Orexin Receptor 1 (HCRTR1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human Orexin Receptor |
FSH Receptor (FSHR) rabbit polyclonal antibody
Applications | ELISA, IF, IHC |
Reactivities | Human |
Immunogen | Synthetic peptide from Human FSHR. (aa278-327) Epitope: Internal |
Rabbit polyclonal anti-HCRTR1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HCRTR1. |
Rabbit polyclonal anti-FSHR antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FSHR. |
Rabbit Polyclonal Anti-FSHR Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | FSH Receptor / FSHR antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human FSHR. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset (100%); Gibbon, Dog, Bat, Elephant, Rabbit, Horse, Pig, Guinea pig (94%); Bovine, Cat, Goat (88%); Mouse, Rat, Sheep (82%). |
Orexin Receptor 1 (HCRTR1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 269-298 amino acids from the Central region of Human Orexin receptor type 1 (Center) |
hCG (CGA) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 74-103 amino acids from the C-terminal region of human TSH-alpha |
Rabbit polyclonal anti-GLP1R antibody
Applications | IF |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLP1R. |
Orexin Receptor 1 / OX1R Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Gorilla, Human, Pig, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | OX1R / Orexin Receptor 1 antibody was raised against synthetic 14 amino acid peptide from 2nd extracellular domain of human HCRTR1 / Orexin Receptor 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Rabbit, Pig, Platypus (100%); Marmoset, Rat, Elephant, Panda, Dog, Bat, Horse (93%); Mouse, Hamster (86%). |
Orexin Receptor 1 / OX1R Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human, Monkey, Rat |
Conjugation | Unconjugated |
Immunogen | OX1R / Orexin Receptor 1 antibody was raised against synthetic 15 amino acid peptide from 3rd cytoplasmic domain of human HCRTR1 / Orexin Receptor 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Dog, Rabbit, Pig (93%); Mouse, Rat, Hamster, Elephant, Panda, Bovine, Bat (87%). |
Orexin Receptor 1 / OX1R Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig |
Immunogen | OX1R / Orexin Receptor 1 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human HCRTR1 / Orexin Receptor 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Horse, Pig (100%); Elephant, Bovine (94%); Marmoset, Panda (88%); Bat (81%). |
Rabbit Polyclonal Anti-HCRTR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HCRTR1 antibody is: synthetic peptide directed towards the N-terminal region of Human HCRTR1. Synthetic peptide located within the following region: ATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYV |
Rabbit Polyclonal Anti-GLP1R Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | GLP1R/GLP-1R/GLP-1 Receptor antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human GLP1R. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Rat, Sheep, Bovine, Hamster, Elephant, Rabbit, Pig (94%). |
Anti-HCRTR1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 393-405 amino acids of Human hypocretin (orexin) receptor 1 |
Anti-HCRTR1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 393-405 amino acids of Human hypocretin (orexin) receptor 1 |
Anti-GLP1R Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 24-145 amino acids of human glucagon-like peptide 1 receptor |
Anti-FSHR Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 28-218 amino acids of human follicle stimulating hormone receptorfollicle stimulating hormone receptor |
Anti-FSHR Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 28-218 amino acids of human follicle stimulating hormone receptor |
Rabbit Polyclonal Anti-CGA Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CGA |
HCRTR1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |