Primary Antibodies

View as table Download

FOXC1 (+FOXC2) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 100-150 of Human FoxC1.

Rabbit Polyclonal Anti-FOXC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXC1 antibody: synthetic peptide directed towards the N terminal of human FOXC1. Synthetic peptide located within the following region: GGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYI

Rabbit polyclonal anti-FOXC1/2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FOXC1/2.
Modifications Phospho-specific

Rabbit Polyclonal Anti-FOXC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXC1 antibody: synthetic peptide directed towards the C terminal of human FOXC1. Synthetic peptide located within the following region: GERGGHLQGAPGGAGGSAVDNPLPDYSLPPVTSSSSSSLSHGGGGGGGGG

Rabbit Polyclonal Anti-FOXC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXC1 antibody: synthetic peptide directed towards the C terminal of human FOXC1. Synthetic peptide located within the following region: QQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDC

Rabbit Polyclonal Anti-Foxc1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Foxc1 antibody: synthetic peptide directed towards the n terminal of mouse Foxc1. Synthetic peptide located within the following region: MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHP

Rabbit Polyclonal Anti-FOXC1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOXC1