Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-IMPA2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IMPA2 antibody: synthetic peptide directed towards the middle region of human IMPA2. Synthetic peptide located within the following region: RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH

Rabbit Polyclonal Anti-IPPK Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IPPK antibody: synthetic peptide directed towards the middle region of human IPPK. Synthetic peptide located within the following region: KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK

Rabbit Polyclonal Anti-PLCD1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLCD1 antibody: synthetic peptide directed towards the N terminal of human PLCD1. Synthetic peptide located within the following region: HWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQ

Rabbit Polyclonal Anti-PLCD1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLCD1 antibody: synthetic peptide directed towards the N terminal of human PLCD1. Synthetic peptide located within the following region: DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH

Rabbit Polyclonal Anti-SHIP1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SHIP1 Antibody: A synthesized peptide derived from human SHIP1

Rabbit Polyclonal Anti-ITPK1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ITPK1 Antibody: A synthesized peptide derived from human ITPK1

Rabbit Polyclonal Anti-PI3-kinase p85-alpha Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PI3-kinase p85-alpha Antibody: A synthesized peptide derived from human PI3-kinase p85-alpha

Rabbit Polyclonal Anti-INPP4B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen INPP4B antibody was raised against a 17 amino acid peptide near the amino terminus of human INPP4B.

DGKI rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Rat
Immunogen Synthetic peptide, corresponding to amino acids 1001-1050 of Human DGK-ι.

CDS1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat
Immunogen Synthetic peptide corresponding to the N-terminal region of human CDS1

INPP5B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 957-987 amino acids from the C-terminal region of Human INPP5B / 5PTase 2.

PIK3R5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 770-800aa) of human PIK3R5.

Rabbit Polyclonal Antibody against PIK3R1 (Y580)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PIK3R1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 558-587 amino acids from human PIK3R1.

Rabbit polyclonal antibody to INPP1 (inositol polyphosphate-1-phosphatase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 3 and 269 of INPP1 (Uniprot ID#P49441)

Rabbit Polyclonal antibody to PI3 kinase p110 beta (phosphoinositide-3-kinase, catalytic, beta polypeptide)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 509 and 820 of PI3 kinase p110 beta (Uniprot ID#P42338)

Rabbit polyclonal anti-DGKA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKA.

Rabbit polyclonal PKC a (Ab-657) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PKC a around the phosphorylation site of tyrosine 657 (F-S-YP-V-N).

Rabbit polyclonal anti-PIK3R5 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PIK3R5.

Rabbit polyclonal anti-DGKB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKB.

Rabbit polyclonal anti-PRKCG antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRKCG.

Rabbit polyclonal anti-DGKQ antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKQ.

Rabbit polyclonal anti-DGKE antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKE.

Rabbit polyclonal anti-PIP5K antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PIP5K.

Anti-PRKCB (Phospho-Thr641) Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of threonine 641 (E-L-T(p)-P-T) derived from Human PKCβ
Modifications Phospho-specific

Rabbit polyclonal PI3KCD Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KCD antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 687-717 amino acids from the C-terminal region of human PI3KCD.

Rabbit polyclonal PI3KCD Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KCD antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 85-114 amino acids from the N-terminal region of human PI3KCD.

Rabbit polyclonal PLCB2 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PLCB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 174-202 amino acids from the N-terminal region of human PLCB2.

Rabbit Polyclonal Calmodulin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against A synthesized peptide derived from human Calmodulin

Rabbit polyclonal PI3-kinase p85-a (Phospho-Tyr607) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PI3-kinase p85-α around the phosphorylation site of tyrosine 607 (D-Q-YP-S-L).
Modifications Phospho-specific

Rabbit polyclonal PRKCG (Ab-655) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PRKCG around the phosphorylation site of threonine 655 (A-L-TP-P-P).

Rabbit Polyclonal Phospho-PKCB (Ser661) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PKCB around the phosphorylation site of Serine 661
Modifications Phospho-specific

Rabbit Polyclonal Phospho-PKC alpha (Thr638) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PKC alpha around the phosphorylation site of Threonine 638
Modifications Phospho-specific

Rabbit Polyclonal Phospho-PKC-pan (Thr497) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PKC-pan around the phosphorylation site of Threonine 497
Modifications Phospho-specific

Rabbit Polyclonal Phospho-PLCG1 (Tyr771) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PLCG1 around the phosphorylation site of Tyrosine 771
Modifications Phospho-specific

Rabbit Polyclonal Phospho-PLCG1 (Tyr783) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PLCG1 around the phosphorylation site of Tyrosine 783
Modifications Phospho-specific

Rabbit Polyclonal Phospho-PTEN (Ser370) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PTEN around the phosphorylation site of Serine 370
Modifications Phospho-specific

Rabbit Polyclonal Phospho-Calmodulin (Thr79+Ser81) Antibody (Phospho-specific)

Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against A synthesized peptide derived from human Calmodulin around the phosphorylation site of Threonine 79+Serine 81
Modifications Phospho-specific

Rabbit Polyclonal PKCB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PKCB

Rabbit Polyclonal PLCG2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PLCG2

Rabbit Polyclonal PKC alpha Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PKC alpha

Rabbit Polyclonal PKC-pan Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PKC-pan

Rabbit Polyclonal PLCG1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PLCG1

Rabbit Polyclonal PLCG1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PLCG1

Rabbit Polyclonal PTEN Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PTEN

Rabbit Polyclonal Phospho-PLCG2 (Tyr753) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human PLCG2 around the phosphorylation site of Tyrosine 753.
Modifications Phospho-specific

Rabbit Polyclonal Anti-DGKH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: EPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQT

Rabbit polyclonal Anti-PRKCG Antibody

Applications Assay, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL

Rabbit Polyclonal Anti-PIP5K1A Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pip5k1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pip5k1a. Synthetic peptide located within the following region: EGPSASVMPVKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLS