Primary Antibodies

View as table Download

Rabbit Polyclonal H3R17me2 Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3R17me2 antibody: histone H3 containing the asymmetrically dimethylated arginine 17 (H3R17me2(asym)), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3 pan Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3 pan antibody: histone H3, using two KLH-conjugated synthetic peptides containing an unmodified sequence from the central part and from the C-terminus of the protein.

Rabbit Polyclonal H3K9me1 Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K9me1 antibody: histone H3 containing the monomethylated lysine 9 (H3K9me1), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K27me3S28p Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K27me3S28p antibody: against histone H3, trimethylated at lysine 27 and phosphorylated at serine 28 (H3K27me3S28p), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K27ac Antibody

Applications Dot, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K27ac antibody: histone H3, acetylated at lysine 27 (H3K27ac), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K64me3 Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K64me3 antibody: histone H3 containing the trimethylated lysine 64 (H3K64me3), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H4K20me1 Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H4K20me1 antibody: histone H4 containing the monomethylated lysine 20 (H4K20me1), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H4K8ac Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H4K8ac antibody: histone H4 containing the acetylated lysine 8 (H4K8ac), using a KLH-conjugated synthetic peptide

Rabbit Polyclonal H4K20me1 Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H4K20me1 antibody: histone H4 containing the monomethylated lysine 20 (H4K20me1), using a KLH-conjugated synthetic peptide.

CD86 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CD86

MonoMethyl-Histone H3-K4 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3

MonoMethyl-Histone H3-K9 Rabbit Polyclonal Antibody

Applications ChIP, Dot, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K9 of human histone H3

DiMethyl-Histone H3-K9 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K9 of human histone H3

TriMethyl-Histone H3-K27 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3

TriMethyl-Histone H3-K36 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic tri-methylated peptide corresponding to residues surrounding K36 of human histone H3

MonoMethyl-Histone H3-K79 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3

DiMethyl-Histone H3-K79 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic peptideof human Histone H3K79me2

Rabbit Polyclonal H3K56ac Antibody

Applications Dot, ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K56ac antibody: the region of histone H3 containing the acetylated lysine 56 (H3K56ac), using a KLH-conjugated synthetic peptide.

DiMethyl-Histone H3-K27 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3

MonoMethyl-Histone H3-K36 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3

MonoMethyl-Histone H3-R26 Rabbit Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding R26 of human histone H3

Rabbit Polyclonal Anti-C4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C4B antibody: synthetic peptide directed towards the N terminal of human C4B. Synthetic peptide located within the following region: QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM

Rabbit Polyclonal H2A.XS139p Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H2A.XS139p antibody: the region of histone H2A.X containing the phosphorylated serine 139 (H2A.XS139p), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K18ac Antibody

Applications Dot, ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K18ac antibody: histone H3 containing the acetylated lysine 18 (H3K18ac), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal Anti-TAF9 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TAF9 antibody was raised against a 17 amino acid peptide near the center of human TAF9.

Rabbit anti-ACTN1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human ACTN1

FCGR2A Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FCGR2A

Rabbit anti-HLA-DPB1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human HLA-DPB1

Symmetric DiMethyl-Histone H3-R2 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding R2 of human histone H3

MonoMethyl-Histone H3-R17 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic mono-methylated peptide peptide corresponding to residues surrounding Arg17of human histone H3

MonoMethyl-Histone H3-R8 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3

Rabbit Polyclonal Anti-ACTN2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the N terminal of human ACTN2. Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH

Rabbit Polyclonal Anti-ACTN2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2. Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD

Rabbit Polyclonal Anti-ACTN4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA

Rabbit Polyclonal H2B pan Antibody

Applications Dot, ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H2B pan antibody: histone H2B using a KLH-conjugated synthetic peptide containing an unmodified sequence from the C-terminal part of the protein.

Rabbit Polyclonal H2A pan Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H2A pan antibody: histone H2A using 2 KLH-conjugated synthetic peptides containing a sequence from the central and the C-terminal part of the protein.

Rabbit Polyclonal H4 pan Antibody

Applications Dot, ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H4 pan antibody: histone H4 using a KLH-conjugated synthetic peptide containing an unmodified sequence from the central part of the protein.

IL10 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10.

TriMethyl-Histone H3-K4 Rabbit Polyclonal Antibody

Applications ChIP, Dot, IHC, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3

Asymmetric DiMethyl-Histone H3-R2 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding R2 of human histone H3

Asymmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3

Rabbit Polyclonal antibody to SSA1 (tripartite motif-containing 21)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 254 and 475 of SSA1 (Uniprot ID#P19474)

Rabbit anti-FCGR1A Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FCGR1A

Asymmetric DiMethyl-Histone H3-R17 Rabbit Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding Arg17of human histone H3

Rabbit Polyclonal Anti-SNRPD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPD1 antibody: synthetic peptide directed towards the N terminal of human SNRPD1. Synthetic peptide located within the following region: NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

Anti-HLA-DRA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha

Asymmetric DiMethyl-Histone H3-R26 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding Arg26 of human histone H3

Symmetric DiMethyl-Histone H3-R17 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding Arg17of human histone H3

Symmetric DiMethyl-Histone H3-R26 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding Arg26 of human histone H3