Germany
Japan
United Kingdom
China
Rabbit Polyclonal ERK1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 |
Primary Antibodies
View as table Download
Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204 |
| Modifications | Phospho-specific |
MEK2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | C term -peptide of human MEK2 |
Rabbit Polyclonal Anti-ADRB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV |
Rabbit anti-PRKG1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRKG1 |
Rabbit Polyclonal Anti-GNAQ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAQ antibody: synthetic peptide directed towards the N terminal of human GNAQ. Synthetic peptide located within the following region: DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK |
Rabbit Polyclonal Anti-Tubb2a Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Tubb2a antibody is: synthetic peptide directed towards the C-terminal region of Mouse Tubb2a. Synthetic peptide located within the following region: RKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEE |
Rabbit Polyclonal Anti-CDC2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF |
Rabbit Polyclonal Anti-CDC2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP |
Rabbit Polyclonal Anti-PRKACA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACA antibody: synthetic peptide directed towards the N terminal of human PRKACA. Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV |
Rabbit Polyclonal Anti-PRKACA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACA antibody: synthetic peptide directed towards the N terminal of human PRKACA. Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV |
Rabbit Polyclonal Anti-TUBA4A Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH |
Rabbit Polyclonal Anti-GNAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the C terminal of human GNAS. Synthetic peptide located within the following region: YFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY |
Rabbit Polyclonal Anti-PDGFRalpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFRalpha Antibody: A synthesized peptide derived from human PDGFRalpha |
Rabbit Polyclonal Anti-RASH/RASK/RASN Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RASH/RASK/RASN Antibody: A synthesized peptide derived from human RASH/RASK/RASN |
Rabbit Polyclonal Anti-KAPC A/B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KAPC A/B Antibody: A synthesized peptide derived from human KAPC A/B |
Rabbit Polyclonal Anti-EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGFR Antibody: A synthesized peptide derived from human EGFR |
Rabbit Polyclonal Anti-Tubulin alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tubulin alpha Antibody: A synthesized peptide derived from human Tubulin alpha |
Rabbit Polyclonal Anti-GCYB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCYB1 Antibody: A synthesized peptide derived from human GCYB1 |
Rabbit Polyclonal Anti-CDC2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 Antibody: A synthesized peptide derived from human CDC2 |
Rabbit Polyclonal Anti-MAPK1/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAPK1/3 Antibody: A synthesized peptide derived from human MAPK1/3 |
Rabbit Polyclonal Anti-C-RAF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C-RAF Antibody: A synthesized peptide derived from human C-RAF |
Rabbit Polyclonal Anti-ZO 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZO 1 Antibody: A synthesized peptide derived from human ZO 1 |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF |
Rabbit Polyclonal Anti-PDGFA Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFA Antibody: A synthesized peptide |
Rabbit Polyclonal Anti-SOS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOS2 Antibody: A synthesized peptide derived from human SOS2 |
Rabbit Polyclonal Anti-Connexin 43 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Connexin 43 Antibody: A synthesized peptide derived from human Connexin 43 |
Rabbit Polyclonal Anti-PDGFR a Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFR a Antibody: A synthesized peptide derived from human PDGFR a |
Rabbit Polyclonal Anti-Phospho-C-RAF(Ser301) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-C-RAF(Ser301) Antibody: A synthesized peptide derived from human C-RAF around the phosphorylation site of Sersine 301 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-QSOX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | QSOX1 antibody was raised against a 17 amino acid peptide near the center of human QSOX1. |
EGF rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Immunogen | Recombinant EGF precursor from Suberites domuncula. |
EGF rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Immunogen | Recombinant EGF precursor from Suberites domuncula. |
PDGF Receptor beta (PDGFRB) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
PDGF Receptor beta (PDGFRB) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 711-760 of Human PDGFR-β. |
Active filters
Antibody Hosts
- Rabbit
Pathways
- Gap junction
Filter by
Category
Target Symbol
- EGFR (79)
- MAP2K1 (26)
- RAF1 (26)
- SRC (23)
- PDGFRB (22)
- CDK1 (20)
- GJA1 (16)
- PRKCA (16)
- EGF (15)
- PDGFB (15)
- MAPK3 (14)
- MAPK1 (13)
- GNAS (12)
- PDGFA (11)
- PRKCB (11)
- PDGFRA (9)
- GRB2 (8)
- GRM1 (8)
- MAP2K2 (8)
- NRAS (8)
- PRKACA (8)
- TUBA1A (8)
- DRD1 (7)
- GRM5 (7)
- HTR2B (7)
- HTR2C (7)
- TUBA4A (7)
- PRKCG (6)
- TUBA1B (6)
- DRD2 (5)
- PDGFC (5)
- TJP1 (5)
- TUBB (5)
- ADCY1 (4)
- ADCY4 (4)
- ADCY5 (4)
- ADRB1 (4)
- CDC2 (4)
- GNA11 (4)
- GUCY1B1 (4)
- HRAS (4)
- LPAR1 (4)
- PLCB3 (4)
- PRKACB (4)
- PRKG1 (4)
- PRKG2 (4)
- TUBA1C (4)
- TUBA3C (4)
- TUBB3 (4)
- ADCY2 (3)
- ADCY6 (3)
- GJD2 (3)
- GNAI1 (3)
- GNAI2 (3)
- GNAI3 (3)
- HTR2A (3)
- MAP2K5 (3)
- PLCB1 (3)
- PRKACG (3)
- PRKX (3)
- SOS2 (3)
- TUBB2A (3)
- ADCY3 (2)
- ADCY8 (2)
- CSNK1D (2)
- GUCY1A1 (2)
- MAP3K2 (2)
- MAPK7 (2)
- PLCB2 (2)
- TUBA3D (2)
- TUBB1 (2)
- TUBB2B (2)
- TUBB4A (2)
- TUBB6 (2)
- ADCY7 (1)
- ADCY9 (1)
- GNAQ (1)
- GUCY1A2 (1)
- GUCY1A3 (1)
- GUCY1B3 (1)
- ITPR1 (1)
- ITPR2 (1)
- ITPR3 (1)
- KRAS (1)
- PDGFD (1)
- SOS1 (1)
- TUBB4Q (1)
- TUBB8 (1)
Reactivities
- Human (425)
- Mouse (318)
- Rat (286)
- Bovine (25)
- Chicken (20)
- Xenopus (11)
- Monkey (8)
- Pig (7)
- Rabbit (6)
- Bat (5)
- Chimpanzee (5)
- Drosophila (5)
- Horse (5)
- Rhesus Monkey (5)
- Dog (4)
- Hamster (4)
- Gorilla (3)
- Canine (2)
- Canis (2)
- Porcine (2)
- Primate (2)
- X. tropicalis (2)
- Zebrafish (2)
- All Species (1)
- Feline (1)
- Murine (1)
- Sheep (1)
Applications
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (569)
- Protein Kinase (312)
- Transmembrane (223)
- ES Cell Differentiation/IPS (187)
- Stem cell relevant signaling - JAK/STAT signaling pathway (102)
- Adult stem cells (99)
- Secreted Protein (92)
- Cancer stem cells (79)
- GPCR (45)
- Stem cell - Pluripotency (28)
- Embryonic stem cells (20)
- Induced pluripotent stem cells (20)
- Ion Channels: Other (19)