Primary Antibodies

View as table Download

CNP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CNP

Rabbit anti-CNP Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CNP

Rabbit Polyclonal Anti-CNPase Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CNPase Antibody: Peptide sequence around aa.80~84 (M-V-S-A-D

rabbit Anti-CNP (2,3-cyclic nucleotide-3-phosphodiesterase) Antibody

Applications WB
Reactivities Human, Mouse, Rabbit, Rat, Sheep
Conjugation Unconjugated
Immunogen Endogenous rabbit 2,3 cyclic nucleotide-3-phospho-diesterase

CNPase (CNP) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-CNP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNP antibody: synthetic peptide directed towards the middle region of human CNP. Synthetic peptide located within the following region: LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII

Rabbit Polyclonal Anti-CNP Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CNP antibody: synthetic peptide directed towards the N terminal of human CNP. Synthetic peptide located within the following region: YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF

Rabbit Polyclonal CNPase Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Reacts with residues 68-84 of the 46-48 (doublet) kDa human, CNPase protein (74% sequence identity and 94% sequence similarity to mouse and rat).

CNP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CNP