CNP rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CNP |
CNP rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CNP |
Rabbit anti-CNP Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CNP |
Rabbit Polyclonal Anti-CNPase Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNPase Antibody: Peptide sequence around aa.80~84 (M-V-S-A-D |
rabbit Anti-CNP (2,3-cyclic nucleotide-3-phosphodiesterase) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rabbit, Rat, Sheep |
Conjugation | Unconjugated |
Immunogen | Endogenous rabbit 2,3 cyclic nucleotide-3-phospho-diesterase |
CNPase (CNP) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CNP Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNP antibody: synthetic peptide directed towards the middle region of human CNP. Synthetic peptide located within the following region: LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII |
Rabbit Polyclonal Anti-CNP Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNP antibody: synthetic peptide directed towards the N terminal of human CNP. Synthetic peptide located within the following region: YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF |
Rabbit Polyclonal CNPase Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Reacts with residues 68-84 of the 46-48 (doublet) kDa human, CNPase protein (74% sequence identity and 94% sequence similarity to mouse and rat). |
CNP rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CNP |