Primary Antibodies

View as table Download

Rabbit Polyclonal Antibody against ATG5

Applications IHC, WB
Reactivities Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0]

Rabbit Polyclonal ATG5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG5 antibody was raised against a 16 amino acid peptide from near the amino terminus of human ATG5.

Rabbit polyclonal ATG5 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This ATG5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human ATG5.

Rabbit polyclonal APG5 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATG5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the full length of human ATG5.

Rabbit Polyclonal Anti-ATG5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATG5 Antibody: synthetic peptide directed towards the C terminal of human ATG5. Synthetic peptide located within the following region: DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

Rabbit Polyclonal Anti-ATG5 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ATG5

ATG5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ATG5

ATG5 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse ATG5

ATG5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ATG5

ATG5 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-275 of human ATG5 (NP_004840.1).
Modifications Unmodified

ATG5 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 28-275 of human ATG5 (NP_004840.1).
Modifications Unmodified

APG5L Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human APG5L/ATG5

APG5L Rabbit monoclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated