Rabbit anti-COPS5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human COPS5 |
Rabbit anti-COPS5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human COPS5 |
Rabbit polyclonal anti-COPS5 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COPS5. |
JAB1 (COPS5) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
JAB1 (COPS5) (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide from N-terminal of human JAB1 protein |
Rabbit Polyclonal Anti-COPS5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COPS5 antibody: synthetic peptide directed towards the N terminal of human COPS5. Synthetic peptide located within the following region: NMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVM |
Rabbit Polyclonal anti-COPS5 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COPS5 antibody: synthetic peptide directed towards the N terminal of human COPS5. Synthetic peptide located within the following region: AASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHY |
Anti-COPS5 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
JAB1/CSN5/COPS5 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-334 of human JAB1/CSN5/JAB1/CSN5/COPS5 (NP_006828.2). |
Modifications | Unmodified |