Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-PRMT3 Antibody
| Applications | 10k-ChIP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRMT3 antibody: synthetic peptide directed towards the middle region of human PRMT3. Synthetic peptide located within the following region: LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK |
Rabbit Polyclonal Anti-PRMT6 Antibody
| Applications | 10k-ChIP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRMT6 antibody: synthetic peptide directed towards the middle region of human PRMT6. Synthetic peptide located within the following region: FRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLY |
Rabbit Polyclonal Anti-TAF2 Antibody
| Applications | 10k-ChIP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAF2 Antibody: synthetic peptide directed towards the middle region of human TAF2. Synthetic peptide located within the following region: RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH |
Rabbit Polyclonal Anti-TAF4 Antibody
| Applications | 10k-ChIP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAF4 Antibody: synthetic peptide directed towards the middle region of human TAF4. Synthetic peptide located within the following region: EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRL |
Rabbit Polyclonal Anti-THRB Antibody
| Applications | 10k-ChIP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THRB antibody: synthetic peptide directed towards the N terminal of human THRB. Synthetic peptide located within the following region: MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK |
Rabbit Polyclonal Anti-HIST1H1C Antibody
| Applications | 10k-ChIP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIST1H1C antibody: synthetic peptide directed towards the middle region of human HIST1H1C. Synthetic peptide located within the following region: ASGSFKLNKKAASGEAKPKVKKAGGTKPKKPVGAAKKPKKAAGGATPKKS |
Rabbit Polyclonal Anti-SMYD2 Antibody
| Applications | 10k-ChIP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMYD2 antibody: synthetic peptide directed towards the middle region of human SMYD2. Synthetic peptide located within the following region: SMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES |
Rabbit Polyclonal Anti-SMYD3 Antibody
| Applications | 10k-ChIP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMYD3 antibody: synthetic peptide directed towards the N terminal of human SMYD3. Synthetic peptide located within the following region: PRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGL |
Rabbit Polyclonal Anti-MED25 Antibody
| Applications | 10k-ChIP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MED25 antibody: synthetic peptide directed towards the N terminal of human MED25. Synthetic peptide located within the following region: EGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYV |
Rabbit Polyclonal Anti-MED25 Antibody
| Applications | 10k-ChIP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MED25 antibody is: synthetic peptide directed towards the C-terminal region of Human MED25. Synthetic peptide located within the following region: PPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDI |
Carrier-free (BSA/glycerol-free) ERCC1 mouse monoclonal antibody, clone 2E12
| Applications | 10k-ChIP, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Beta-Catenin (CTNNB1) mouse monoclonal antibody, clone UMAB15
| Applications | 10k-ChIP, FC, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Beta-Catenin (CTNNB1) mouse monoclonal antibody, clone UMAB15
| Applications | 10k-ChIP, FC, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Applications
- 10k-ChIP
Filter by
Category
Target Symbol
- ERBB2 (12)
- NME1 (12)
- PECAM1 (12)
- ERCC4 (9)
- IDO1 (9)
- KRT19 (9)
- LGR5 (9)
- NCAM1 (9)
- PDCD1 (9)
- PYM1 (9)
- ABAT (6)
- AMACR (6)
- CD2 (6)
- CTAG1B (6)
- CTNNB1 (6)
- DDX56 (6)
- ERCC1 (6)
- ERG (6)
- FCGR2A (6)
- FOLH1 (6)
- FOXP1 (6)
- KRT20 (6)
- LGALS3 (6)
- MSR1 (6)
- NBN (6)
- NKX3-1 (6)
- PBX1 (6)
- PDCD1LG2 (6)
- POU2AF1 (6)
- PROCR (6)
- RTRAF (6)
- S100A9 (6)
- SYT4 (6)
- TNFRSF4 (6)
- TP53 (6)
- VSIR (6)
- WFDC2 (6)
- AFP (3)
- ALX4 (3)
- BBOX1 (3)
- BMP4 (3)
- CD1C (3)
- CD40 (3)
- CD68 (3)
- CD74 (3)
- CD80 (3)
- CDH1 (3)
- CRABP2 (3)
- DEF6 (3)
- EGFR (3)
- EPCAM (3)
- FCGR1A (3)
- FGF21 (3)
- FOS (3)
- FOXP3 (3)
- GATA3 (3)
- GBA (3)
- GEMIN8 (3)
- GLI1 (3)
- HADH (3)
- HAO1 (3)
- HEMGN (3)
- HP (3)
- ICOSLG (3)
- JUN (3)
- KRT8 (3)
- L1CAM (3)
- MLANA (3)
- MME (3)
- MMP7 (3)
- MRPS34 (3)
- MS4A1 (3)
- MSI1 (3)
- MUC1 (3)
- NAPSA (3)
- PARN (3)
- PDSS2 (3)
- RAPGEF1 (3)
- S100P (3)
- SDCBP (3)
- SERPINB4 (3)
- SLC7A8 (3)
- SOX5 (3)
- SQSTM1 (3)
- SYP (3)
- TLE1 (3)
- TNFRSF18 (3)
- TNFRSF8 (3)
- TNNC1 (3)
- TNNT2 (3)
- UCHL1 (3)
- VBP1 (3)
- VIL1 (3)
- XRCC1 (3)
- ZSCAN18 (3)
- MED25 (2)
- HIST1H1C (1)
- KMT5B (1)
- PRMT3 (1)
- PRMT6 (1)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Families
- Druggable Genome (274)
- Transmembrane (174)
- Transcription Factors (74)
- ES Cell Differentiation/IPS (66)
- Secreted Protein (48)
- Stem cell - Pluripotency (27)
- Protease (22)
- Adult stem cells (15)
- Protein Kinase (15)
- Cancer stem cells (9)
- Embryonic stem cells (9)
- GPCR (9)
- Stem cell relevant signaling - JAK/STAT signaling pathway (6)
- Induced pluripotent stem cells (3)
- Stem cell relevant signaling - DSL/Notch pathway (3)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (3)
- Nuclear Hormone Receptor (1)
Pathways
- Cell adhesion molecules (CAMs) (57)
- Pathways in cancer (51)
- Metabolic pathways (42)
- Prostate cancer (33)
- Endometrial cancer (30)
- Focal adhesion (27)
- Adherens junction (24)
- Bladder cancer (24)
- Colorectal cancer (21)
- Non-small cell lung cancer (21)
- Pancreatic cancer (21)
- Basal cell carcinoma (18)
- Calcium signaling pathway (18)
- Cytokine-cytokine receptor interaction (18)
- ErbB signaling pathway (18)
- Hematopoietic cell lineage (18)
- Leukocyte transendothelial migration (18)
- MAPK signaling pathway (18)
- Wnt signaling pathway (18)
- Melanoma (15)
- Nucleotide excision repair (15)
- Systemic lupus erythematosus (15)
- T cell receptor signaling pathway (15)
- Thyroid cancer (15)
- Neurotrophin signaling pathway (12)
- Purine metabolism (12)
- Pyrimidine metabolism (12)
- Toll-like receptor signaling pathway (12)
- Tryptophan metabolism (12)
- Butanoate metabolism (9)
- Fc gamma R-mediated phagocytosis (9)
- Glioma (9)
- Lysosome (9)
- Pathogenic Escherichia coli infection (9)
- Prion diseases (9)
- Valine (9)
- leucine and isoleucine degradation (9)
- Huntington's disease (7)
- Alanine (6)
- Allograft rejection (6)
- Amyotrophic lateral sclerosis (ALS) (6)
- Apoptosis (6)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (6)
- Autoimmune thyroid disease (6)
- B cell receptor signaling pathway (6)
- Cardiac muscle contraction (6)
- Cell cycle (6)
- Chronic myeloid leukemia (6)
- Dilated cardiomyopathy (6)
- Epithelial cell signaling in Helicobacter pylori infection (6)
- GnRH signaling pathway (6)
- Hedgehog signaling pathway (6)
- Homologous recombination (6)
- Hypertrophic cardiomyopathy (HCM) (6)
- Lysine degradation (6)
- Melanogenesis (6)
- Primary bile acid biosynthesis (6)
- Propanoate metabolism (6)
- Regulation of actin cytoskeleton (6)
- Renal cell carcinoma (6)
- Small cell lung cancer (6)
- Tight junction (6)
- Viral myocarditis (6)
- aspartate and glutamate metabolism (6)
- beta-Alanine metabolism (6)
- p53 signaling pathway (6)
- Alzheimer's disease (3)
- Antigen processing and presentation (3)
- Asthma (3)
- Axon guidance (3)
- Base excision repair (3)
- Dorso-ventral axis formation (3)
- Endocytosis (3)
- Fatty acid elongation in mitochondria (3)
- Fatty acid metabolism (3)
- Gap junction (3)
- Glyoxylate and dicarboxylate metabolism (3)
- Graft-versus-host disease (3)
- Insulin signaling pathway (3)
- Other glycan degradation (3)
- Parkinson's disease (3)
- Primary immunodeficiency (3)
- RNA degradation (3)
- Renin-angiotensin system (3)
- Sphingolipid metabolism (3)
- TGF-beta signaling pathway (3)
- Terpenoid backbone biosynthesis (3)
- Type I diabetes mellitus (3)
- Basal transcription factors (2)
- Neuroactive ligand-receptor interaction (1)