Rabbit Polyclonal Fibronectin Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Fibronectin Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Fibronectin Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Fibronectin Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Fibronectin Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Fibronectin Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal IKB alpha Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Integrin alpha V Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal COX2 Antibody
Applications | ELISA |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Bcl2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Fibronectin (FN1) mouse monoclonal antibody, clone FND5
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Collagen IV (COL4A1) mouse monoclonal antibody, clone 2F11, FITC
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | FITC |
Collagen IV (COL4A1) mouse monoclonal antibody, clone 2F11, Purified
Applications | ELISA, IHC |
Reactivities | Human |
Collagen IV (COL4A1) mouse monoclonal antibody, clone 2F11, PE
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | PE |
eNOS (NOS3) mouse monoclonal antibody, clone 6H2, Ascites
Applications | ELISA, IHC |
Reactivities | Human |
USD 1,005.00
2 Weeks
Fibronectin (FN1) (Plasma) mouse monoclonal antibody, clone B714M, Purified
Applications | ELISA, WB |
Reactivities | Human |
CDK4 mouse monoclonal antibody, clone AT6D10, Purified
Applications | ELISA, WB |
Reactivities | Human |
CDK4 mouse monoclonal antibody, clone AT6D10, Purified
Applications | ELISA, WB |
Reactivities | Human |
PIAS2 (431-445) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Bat, Canine, Equine, Human, Rabbit |
Immunogen | Synthetic peptide from an internal region of human PIAS2 |
PIAS2 (185-196) goat polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Bovine, Canine, Human, Mouse, Rat |
Immunogen | Peptide with sequence PQQVREICISRD, from the internal region of the protein sequence according to NP_775298.1; NP_004662.2. |
Mouse monoclonal anti-AKT1 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
AKT1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2B9
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700055 |
Anti-TP53 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-233 amino acids of human tumor protein p53 |
Anti-BIRC2 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human baculoviral IAP repeat containing 2 |
Anti-CASP9 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 139-389 amino acids of Human Caspase-9 |
Anti-TRAF2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 351-496 amino acids of human TNF receptor-associated factor 2 |
Anti-E2F2 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-NFKB1p105 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 350 amino acid of Human Nuclear factor NF-kappa-B p105 subunit |
Anti-FN1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 32-280 amino acids of human fibronectin 1 |
Anti-TRAF5 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 403-557 amino acids of human TNF receptor-associated factor 5 |
Anti-AKT1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 10-224 amino acids of human V-akt murine thymoma viral oncogene homolog 1 |
Anti-CDK6 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 13-300 amino acids of Human Cyclin-dependent kinase 6 |
Anti-FHIT Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-TRAF1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 182-412 amino acids of human TNF receptor-associated factor 1 |
Rabbit Polyclonal Anti-IKBKG Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IKBKG |
USD 399.00
In Stock
AKT2 biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone OTI8D9
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600009 |
USD 399.00
In Stock
AKT2 biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone OTI1A2
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600010 |
USD 399.00
In Stock
AKT1 biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone OTI4C11
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600055 |
USD 399.00
In Stock
MYC biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone OTI1A6
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600496 |
USD 399.00
In Stock
MYC biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone OTI3F2
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600497 |