Germany
Japan
United Kingdom
China
Rabbit Polyclonal Fibronectin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Primary Antibodies
View as table Download
Rabbit Polyclonal Fibronectin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Fibronectin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Fibronectin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Fibronectin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal IKB alpha Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Integrin alpha V Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal COX2 Antibody
| Applications | ELISA |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Bcl2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Fibronectin (FN1) mouse monoclonal antibody, clone FND5
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Collagen IV (COL4A1) mouse monoclonal antibody, clone 2F11, FITC
| Applications | ELISA, IHC |
| Reactivities | Human |
| Conjugation | FITC |
Collagen IV (COL4A1) mouse monoclonal antibody, clone 2F11, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
Collagen IV (COL4A1) mouse monoclonal antibody, clone 2F11, PE
| Applications | ELISA, IHC |
| Reactivities | Human |
| Conjugation | PE |
USD 1,005.00
2 Weeks
Fibronectin (FN1) (Plasma) mouse monoclonal antibody, clone B714M, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
CDK4 mouse monoclonal antibody, clone AT6D10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
CDK4 mouse monoclonal antibody, clone AT6D10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
PIAS2 (185-196) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Rat |
| Immunogen | Peptide with sequence PQQVREICISRD, from the internal region of the protein sequence according to NP_775298.1; NP_004662.2. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Anti-TP53 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-233 amino acids of human tumor protein p53 |
Anti-BIRC2 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human baculoviral IAP repeat containing 2 |
Anti-CASP9 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 139-389 amino acids of Human Caspase-9 |
Anti-TRAF2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 351-496 amino acids of human TNF receptor-associated factor 2 |
Anti-E2F2 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-NFKB1p105 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 350 amino acid of Human Nuclear factor NF-kappa-B p105 subunit |
Anti-FN1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 32-280 amino acids of human fibronectin 1 |
Anti-TRAF5 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 403-557 amino acids of human TNF receptor-associated factor 5 |
Anti-AKT1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 10-224 amino acids of human V-akt murine thymoma viral oncogene homolog 1 |
Anti-CDK6 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 13-300 amino acids of Human Cyclin-dependent kinase 6 |
Anti-FHIT Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-TRAF1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 182-412 amino acids of human TNF receptor-associated factor 1 |
Rabbit Polyclonal Anti-IKBKG Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IKBKG |
USD 399.00
In Stock
USD 399.00
In Stock
USD 399.00
In Stock
USD 399.00
In Stock
USD 399.00
In Stock
Active filters
Applications
- ELISA
Pathways
- Small cell lung cancer
Filter by
Category
Target Symbol
- MYC (13)
- FN1 (10)
- COL4A1 (9)
- AKT1 (7)
- AKT2 (6)
- TP53 (4)
- BCL2 (3)
- LAMA4 (3)
- NOS3 (3)
- CASP9 (2)
- CDK4 (2)
- CDK6 (2)
- ITGAV (2)
- PIAS2 (2)
- AKT3 (1)
- BIRC2 (1)
- BIRC3 (1)
- CCND1 (1)
- CCNE2 (1)
- CDKN1B (1)
- E2F1 (1)
- E2F2 (1)
- FHIT (1)
- IKBKG (1)
- ITGA6 (1)
- LAMA5 (1)
- LAMB1 (1)
- LAMC2 (1)
- NFKB1 (1)
- NFKBIA (1)
- NOS2 (1)
- PIAS1 (1)
- PIAS3 (1)
- PTGS2 (1)
- TRAF1 (1)
- TRAF2 (1)
- TRAF5 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Assay Types
Assay Platforms
Families
- Druggable Genome (78)
- ES Cell Differentiation/IPS (30)
- Stem cell - Pluripotency (25)
- Transcription Factors (25)
- Protein Kinase (18)
- Stem cell relevant signaling - JAK/STAT signaling pathway (16)
- Secreted Protein (15)
- Stem cell relevant signaling - Wnt Signaling pathway (14)
- Embryonic stem cells (13)
- Induced pluripotent stem cells (13)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (13)
- Transmembrane (6)
- Protease (2)
- Stem cell relevant signaling - DSL/Notch pathway (1)