Primary Antibodies

Jump to Filters
View as table Download
WNT2B Rabbit Polyclonal Antibody
TA317518

USD 425.00

In Stock

WNT2B Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%).
GSK3 beta (GSK3B) Rabbit Polyclonal Antibody
TA317698

USD 425.00

In Stock

GSK3B / GSK3 Beta Rabbit Polyclonal (pSer9) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GSK3B / GSK3 Beta antibody was raised against synthetic peptide from human GSK3B / GSK3 Beta.
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA317706

USD 425.00

In Stock

GNAS Rabbit Polyclonal (aa385-394) Antibody

Applications IHC
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen GNAS antibody was raised against synthetic peptide from human GNAS.
DVL1 Rabbit Polyclonal Antibody
TA324487

USD 450.00

5 Days

Rabbit polyclonal DVL1 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This DVL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 442-470 amino acids from the Central region of human DVL1.
CREB1 Rabbit Polyclonal Antibody
TA325386

USD 345.00

4 Weeks

Rabbit Polyclonal CREB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human CREB.
p21 Ras (HRAS) Rabbit Polyclonal Antibody
TA326254

USD 345.00

In Stock

Rabbit polyclonal RASH/RASK/RASN antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human RASH/RASK/RASN antibody.
MC1 Receptor (MC1R) Rabbit Polyclonal Antibody
TA328624

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-Melanocortin Receptor 1

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HAQGIARLHKRQRPVH, corresponding to amino acid residues 217-232 of human MC1R. 3rd intracellular loop.
TRP1 (TYRP1) Rabbit Polyclonal Antibody
TA335249

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-TYRP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP
WNT10B Rabbit Polyclonal Antibody
TA344059

USD 475.00

5 Days

Rabbit Polyclonal Anti-WNT10B Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT10B antibody: synthetic peptide directed towards the middle region of human WNT10B. Synthetic peptide located within the following region: GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
Frizzled 5 (FZD5) Rabbit Polyclonal Antibody
TA344062

USD 475.00

5 Days

Rabbit Polyclonal Anti-FZD5 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the middle region of human FZD5. Synthetic peptide located within the following region: CYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGIT
WNT7B Rabbit Polyclonal Antibody
TA344089

USD 475.00

5 Days

Rabbit Polyclonal Anti-WNT7B Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM
ACTH (POMC) Goat Polyclonal Antibody
TA303016

USD 375.00

5 Days

Goat Polyclonal Antibody against POMC

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-NAIIKNAYKKGE, from the C Terminus of the protein sequence according to NP_000930.1; NP_001030333.1.
p21 Ras (HRAS) Rabbit Polyclonal Antibody
TA308498

USD 415.00

5 Days

Rabbit polyclonal antibody to H-Ras (v-Ha-ras Harvey rat sarcoma viral oncogene homolog)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 111 and 189 of H-Ras (Uniprot ID#P01112)
RAF1 Rabbit Polyclonal Antibody
TA313058

USD 345.00

In Stock

Rabbit polyclonal C-RAF (Thr269) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human C-RAF around the phosphorylation site of threonine 269 (S-T-TP-L-P).
Modifications Phospho-specific
ADCY8 Rabbit Polyclonal Antibody
TA313427

USD 345.00

4 Weeks

Rabbit polyclonal anti-ADCY8 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCY8.
CREB1 Rabbit Polyclonal Antibody
TA313687

USD 345.00

4 Weeks

Rabbit polyclonal CREB (Ser133) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CREB around the phosphorylation site of serine 133 (R-P-SP-Y-R).
Modifications Phospho-specific
EP300 Rabbit Polyclonal Antibody
TA313819

USD 345.00

4 Weeks

Rabbit polyclonal anti-p300 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human p300.
PRKACA Rabbit Polyclonal Antibody
TA314379

USD 345.00

4 Weeks

Rabbit polyclonal PKA CAT (Ab-197) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C).
WNT1 Rabbit Polyclonal Antibody
TA314674

USD 345.00

In Stock

Rabbit polyclonal anti-WNT1 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human WNT1.
Frizzled 6 (FZD6) Rabbit Polyclonal Antibody
TA314727

USD 345.00

4 Weeks

Rabbit polyclonal anti-FZD6 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD6.
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
TA319264

USD 530.00

5 Days

Rabbit polyclonal beta Catenin antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus.
MEK2 (MAP2K2) Rabbit Polyclonal Antibody
TA321906

USD 345.00

4 Weeks

Anti-MAP2K2 (Phospho-Thr394) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of threonine 394 (P-G-T(p)-P-T) derived from Human MEK-2.
Modifications Phospho-specific
Dishevelled 3 (DVL3) Rabbit Polyclonal Antibody
TA324462

USD 450.00

5 Days

Rabbit polyclonal DVL3 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This DVL3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 530-557 amino acids from the C-terminal region of human DVL3.
Frizzled homolog 1 (FZD1) Rabbit Polyclonal Antibody
TA324732

USD 450.00

5 Days

Rabbit polyclonal FZD1 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FZD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the Central region of human FZD1.
GSK3 beta (GSK3B) Rabbit Polyclonal Antibody
TA324769

USD 450.00

5 Days

Rabbit polyclonal Bi-Phospho-GSK3B(S21/29) Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GSK3B Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S21/29 of human GSK3B.
Modifications Phospho-specific
WNT10B Rabbit Polyclonal Antibody
TA324853

USD 450.00

5 Days

Rabbit polyclonal WNT10B Antibody (Center)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This WNT10B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 193-222 amino acids from the Central region of human WNT10B.
ERK2 (MAPK1) Rabbit Polyclonal Antibody
TA324912

USD 450.00

5 Days

Rabbit polyclonal MAPK1 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human MAPK1.
ERK1 (MAPK3) Rabbit Polyclonal Antibody
TA324941

USD 450.00

5 Days

Rabbit polyclonal MAPK3 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3.
ERK2 (MAPK1) Rabbit Polyclonal Antibody
TA324942

USD 450.00

5 Days

Rabbit polyclonal MAPK1 Antibody (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 254-285 amino acids from the C-terminal region of human MAPK1.
NRAS Rabbit Polyclonal Antibody
TA324983

USD 450.00

5 Days

Rabbit polyclonal NRAS Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 147-179 amino acids from the C-terminal region of human NRAS.
MEK2 (MAP2K2) Rabbit Polyclonal Antibody
TA325009

USD 450.00

5 Days

Rabbit polyclonal MEK2 (MAP2K2) Antibody (Center)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This MEK2 (MAP2K2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-292 amino acids from the Central region of human MEK2 (MAP2K2).
Phospholipase C beta 2 (PLCB2) Rabbit Polyclonal Antibody
TA325098

USD 450.00

5 Days

Rabbit polyclonal PLCB2 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PLCB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 174-202 amino acids from the N-terminal region of human PLCB2.
SCF (KITLG) Rabbit Polyclonal Antibody
TA328440

USD 285.00

5 Days

Anti-Human SCF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human SCF
LEF1 Rabbit Polyclonal Antibody
TA330286

USD 310.00

5 Days

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ
G0 Protein alpha (GNAO1) Rabbit Polyclonal Antibody
TA333538

USD 375.00

5 Days

Rabbit Polyclonal Anti-GNAO1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the middle region of human GNAO1. Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL
beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: 12F7]
TA336809

USD 424.00

5 Days

Mouse Monoclonal beta-Catenin Antibody (12F7)

Applications IHC, WB
Reactivities Human, Mouse, Rat, Chicken, Primate
Conjugation Unconjugated
WNT5A Rabbit Polyclonal Antibody
TA337059

USD 457.00

5 Days

Rabbit Polyclonal Wnt-5a Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2.
ACTH (POMC) (1-39) Rabbit Polyclonal Antibody
20070

USD 320.00

3 Days

ACTH (POMC) (1-39) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Rat
Conjugation Unconjugated
Immunogen Adrenocorticotropic hormone (ACTH) corresponding to amino acids (1-39) generated against porcine pituitary
G protein alpha S (GNAS) (164-394) Rabbit Polyclonal Antibody
AP23581PU-N

USD 440.00

2 Weeks

G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS
ACTH (POMC) Rabbit Polyclonal Antibody
RA21003-50

USD 265.00

2 Weeks

ACTH (POMC) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA302123

USD 450.00

5 Days

Rabbit Polyclonal Antibody against PRKCB1 (C-term)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen This PKC beta2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-673 amino acids from the C-terminal region of human PKC beta2.
MEK1 (MAP2K1) Rabbit Polyclonal Antibody
TA302209

USD 450.00

5 Days

Rabbit Polyclonal Antibody against MAP2K1 (T291)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MAP2K1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 270-299 amino acids from human MAP2K1.
WNT3 Goat Polyclonal Antibody
TA302636

USD 375.00

5 Days

Goat Polyclonal Antibody against WNT3

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence CGRGHNTRTEKRKEK, from the internal region of the protein sequence according to NP_110380.1.
AIBZIP (CREB3L4) Goat Polyclonal Antibody
TA302777

USD 375.00

5 Days

Goat Polyclonal Antibody against CREB3L4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PSGRIRSVLHADEM, from the C Terminus of the protein sequence according to NP_570968.
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA308888

USD 415.00

5 Days

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2)
PKC alpha (PRKCA) Rabbit Polyclonal Antibody
TA308938

USD 415.00

5 Days

Rabbit Polyclonal antibody to PKC alpha (protein kinase C, alpha)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 250 of PKC alpha (Uniprot ID#P17252)
CREB3L1 Goat Polyclonal Antibody
TA311556

USD 375.00

5 Days

Goat Anti-OASIS / CREB3L1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DFSHSKEWFHDRD, from the C Terminus of the protein sequence according to NP_443086.1.
RAF1 Rabbit Polyclonal Antibody
TA313056

USD 345.00

4 Weeks

Rabbit polyclonal Raf1 (Ser621) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-SP-E-P).
Modifications Phospho-specific
GSK3 beta (GSK3B) Rabbit Polyclonal Antibody
TA313125

USD 345.00

4 Weeks

Rabbit polyclonal GSK3beta (Ab-9) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GSK3β
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
TA313142

USD 345.00

4 Weeks

Rabbit polyclonal beta-Catenin (Ser37) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human β-Catenin around the phosphorylation site of serine 37 (I-H-SP-G-A).
Modifications Phospho-specific