Primary Antibodies

View as table Download

ANXA1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANXA1

Rabbit polyclonal antibody to Annexin A1 (annexin A1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of Annexin A1 (Uniprot ID#P04083)

Mouse Monoclonal Annexin A1 Antibody (2F1)

Applications IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated

Rabbit Polyclonal Anti-ANXA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA1 antibody: synthetic peptide directed towards the N terminal of human ANXA1. Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD

Carrier-free (BSA/glycerol-free) ANXA1 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-ANXA1 (Annexin A1) mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-ANXA1 (Annexin A1) mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated