Rabbit anti-ALDH2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH2 |
Rabbit anti-ALDH2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH2 |
Rabbit anti-AKR1A1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AKR1A1 |
Rabbit Polyclonal Anti-PPAP2A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL |
Goat Polyclonal Antibody against PNPLA3
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence EHDICPKVKSTN, from the internal region of the protein sequence according to NP_473429.2. |
Rabbit Polyclonal GPAT1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GPAT1 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of the human GPAT1. The immunogen is located within amino acids 730 - 780 of GPAT1. |
Rabbit polyclonal anti-GLCTK antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLCTK. |
Rabbit Polyclonal Antibody against ALDH2 (Center)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2. |
Rabbit polyclonal anti-DGKH antibody
Applications | IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKH. |
Anti-PPAP2C rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 256-269 amino acids of Human phosphatidic acid phosphatase type 2C |
Rabbit Polyclonal antibody to Glycerol kinase 2 (glycerol kinase 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 67 and 338 of Glycerol kinase 2 (Uniprot ID#Q14410) |
Goat Polyclonal Antibody against Aldehyde Reductase
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DAGHPLYPFNDPY, from the C Terminus of the protein sequence according to NP_006057.1; NP_697021.1. |
Goat Polyclonal Antibody against Monoglyceride Lipase
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QDLPHLVNADGQY, from the internal region (near N-Terminus) of the protein sequence according to NP_009214.1; NP_001003794.1. |
Goat Anti-DGAT2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KLEHPTQQDIDLYH, from the internal region (near the C Terminus) of the protein sequence according to NP_115953.2. |
Rabbit Polyclonal Anti-DGKH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI9F1 (formerly 9F1)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI8E12 (formerly 8E12)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI8H2 (formerly 8H2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI10E11 (formerly 10E11)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI6E3 (formerly 6E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI3C7 (formerly 3C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKR1A1 mouse monoclonal antibody, clone OTI4G6 (formerly 4G6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPL mouse monoclonal antibody, clone OTI3C8 (formerly 3C8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPL mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPL mouse monoclonal antibody, clone OTI5C6 (formerly 5C6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPL mouse monoclonal antibody, clone OTI6A10 (formerly 6A10)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPL mouse monoclonal antibody, clone OTI4F6 (formerly 4F6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPL mouse monoclonal antibody, clone OTI3A10 (formerly 3A10)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPL mouse monoclonal antibody, clone OTI4G7 (formerly 4G7)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DGKZ mouse monoclonal antibody,clone OTI1A6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH7A1 mouse monoclonal antibody,clone OTI10A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH7A1 mouse monoclonal antibody,clone OTI1A9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-AGPAT4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 146-306 amino acids of human 1-acylglycerol-3-phosphate O-acyltransferase 4 |
Anti-PPAP2A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A |
Anti-PPAP2A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A |
Anti-AKR1B1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-AKR1B1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-AKR1B1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 304-316 amino acids of human aldo-keto reductase family 1, member B1 (aldose reductase) |
Anti-AKR1B1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 304-316 amino acids of human aldo-keto reductase family 1, member B1 (aldose reductase) |
Anti-ALDH9A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1 |
Anti-ALDH9A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1 |
Anti-AKR1A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 312-324 amino acids of human aldo-keto reductase family 1, member A1 (aldehyde reductase) |
Anti-AKR1A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 312-324 amino acids of human aldo-keto reductase family 1, member A1 (aldehyde reductase) |
Rabbit Polyclonal Anti-GK Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GK |
Rabbit Polyclonal Anti-GPAM Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GPAM |
Rabbit Polyclonal Anti-PNLIP Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PNLIP |
Rabbit Polyclonal Anti-DGKZ Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DGKZ |
Rabbit Polyclonal Anti-DGKB Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DGKB |
Rabbit Polyclonal Anti-CEL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CEL |