Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 111 results

Page 1 of 3

(reset)

ACAT1 Rabbit Polyclonal Antibody

TA332618

USD 275.00

3 Weeks

Rabbit anti-ACAT1 Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human ACAT1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

MVD Rabbit Polyclonal Antibody

TA307889

USD 415.00

In Stock

Rabbit Polyclonal antibody to MVD (mevalonate (diphospho) decarboxylase)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 156 and 371 of MVD (Uniprot ID#P53602)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GGPS1 Rabbit Polyclonal Antibody

TA346695

USD 475.00

5 Days

Rabbit Polyclonal Anti-GGPS1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-GGPS1 antibody: synthetic peptide directed towards the middle region of human GGPS1. Synthetic peptide located within the following region: LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ

1 / 2

2 / 2

Previous Next

HMGCS1 Rabbit Polyclonal Antibody

TA346705

USD 475.00

5 Days

Rabbit Polyclonal Anti-HMGCS1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-HMGCS1 antibody: synthetic peptide directed towards the middle region of human HMGCS1. Synthetic peptide located within the following region: KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA

1 / 2

2 / 2

Previous Next

FDPS Rabbit Monoclonal Antibody [Clone ID: EPR4628]

TA307581

USD 509.00

In Stock

Rabbit monoclonal antibody against FDPS(clone EPR4628)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

MVK Rabbit Polyclonal Antibody

TA313341

USD 345.00

In Stock

Rabbit polyclonal Mevalonate Kinase antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human Mevalonate Kinase.

1 / 2

2 / 2

Previous Next

ACAT2 Rabbit Polyclonal Antibody

TA331169

USD 310.00

5 Days

Rabbit Polyclonal Anti-ACAT2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR

1 / 2

2 / 2

Previous Next

FDPS Rabbit Polyclonal Antibody

TA324717

USD 450.00

5 Days

Rabbit polyclonal FDPS Antibody (N-term)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This FDPS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 82-112 amino acids from the N-terminal region of human FDPS.

1 / 3

2 / 3

3 / 3

Previous Next

IDI1 Rabbit Polyclonal Antibody

TA308665

USD 415.00

5 Days

Rabbit polyclonal antibody to IDI1 (isopentenyl-diphosphate delta isomerase 1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 173 of IDI1 (Uniprot ID#Q13907)

1 / 2

2 / 2

Previous Next

ACAT1 Rabbit Polyclonal Antibody

TA336252

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACAT1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH

1 / 2

2 / 2

Previous Next

ACAT1 Rabbit Polyclonal Antibody

TA336253

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACAT1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL

1 / 2

2 / 2

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A11]

CF501217

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5F7]

CF501219

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1G6]

CF501220

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI7B1]

CF501221

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3E2]

CF501222

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3C9]

CF501223

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5C9]

CF501224

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5A2]

CF501225

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1B7]

CF501238

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

GGPS1 Mouse Monoclonal Antibody [Clone ID: OTI3F9]

CF501731

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GGPS1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PDSS2 Mouse Monoclonal Antibody [Clone ID: OTI1D2]

CF503935

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDSS2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PDSS2 Mouse Monoclonal Antibody [Clone ID: OTI1D10]

CF503936

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDSS2 mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

PDSS2 Mouse Monoclonal Antibody [Clone ID: OTI1D12]

CF503951

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PDSS2 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

PDSS2 Mouse Monoclonal Antibody [Clone ID: OTI2A3]

CF503952

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDSS2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PDSS2 Mouse Monoclonal Antibody [Clone ID: OTI1D6]

CF503972

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDSS2 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PDSS2 Mouse Monoclonal Antibody [Clone ID: OTI1E9]

CF503973

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDSS2 mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PDSS2 Mouse Monoclonal Antibody [Clone ID: OTI1C11]

CF503976

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDSS2 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

PDSS2 Mouse Monoclonal Antibody [Clone ID: OTI4F9]

CF503977

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDSS2 mouse monoclonal antibody, clone OTI4F9 (formerly 4F9)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

HMGCR Rabbit Polyclonal Antibody

TA350050

USD 345.00

In Stock

Rabbit Polyclonal Anti-HMGCR Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human HMGCR

1 / 3

2 / 3

3 / 3

Previous Next

MVK Rabbit Polyclonal Antibody

TA350193

USD 345.00

In Stock

Rabbit Polyclonal Anti-MVK Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human MVK

HMGCS1 Rabbit Polyclonal Antibody

TA351250

USD 345.00

In Stock

Rabbit Polyclonal Anti-HMGCS1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human HMGCS1

HMGCS2 Rabbit Polyclonal Antibody

TA351251

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-HMGCS2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human HMGCS2

MVD Rabbit Polyclonal Antibody

TA351419

USD 345.00

In Stock

Rabbit Polyclonal Anti-MVD Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human MVD

1 / 2

2 / 2

Previous Next

PDSS2 Rabbit Polyclonal Antibody

TA351510

USD 345.00

In Stock

Rabbit Polyclonal Anti-PDSS2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human PDSS2

1 / 3

2 / 3

3 / 3

Previous Next

FDPS Rabbit Polyclonal Antibody

TA357736

USD 360.00

5 Days

FDPS Antibody - C-terminal region

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A11]

TA501217

USD 379.00

In Stock

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A11]

TA501217AM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A11]

TA501217BM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A11]

TA501217S

USD 159.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5F7]

TA501219

USD 379.00

In Stock

Anti-ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F7]

TA501219AM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F7]

TA501219BM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5F7]

TA501219S

USD 159.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1G6]

TA501220

USD 379.00

In Stock

Anti-ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G6]

TA501220AM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]

TA501220BM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1G6]

TA501220S

USD 159.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI7B1]

TA501221

USD 379.00

In Stock

ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7B1]

TA501221AM

USD 420.00

4 Weeks

ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Biotin

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

1 - 50 of 111 results

Page 1 of 3