POLR2A Rabbit Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLR2A |
POLR2A Rabbit Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLR2A |
Rabbit polyclonal POLR2A (Ab-1619) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human POLR2A around the phosphorylation site of serine 1619 (P-T-S-P-S). |
Rabbit Polyclonal RNA Polymerase II/POLR2A [p Thr4] Antibody
Applications | Dot, WB |
Reactivities | Human, Chicken, Drosophila, Yeast |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a phosphorylated Threonine (position 4) of the CTD heptad in the human RNA polymerase II protein [UniProt P24928] |
Mouse Monoclonal RNA polymerase II Antibody (4H8)
Applications | WB |
Reactivities | Human, Mouse, Yeast |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-POLR2A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR2A antibody is: synthetic peptide directed towards the N-terminal region of Human POLR2A. Synthetic peptide located within the following region: DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQ |
Carrier-free (BSA/glycerol-free) POLR2A mouse monoclonal antibody,clone OTI1E5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLR2A mouse monoclonal antibody,clone OTI2B7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLR2A mouse monoclonal antibody,clone OTI3C8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
POLR2A Rabbit polyclonal Antibody
Applications | ChIP, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human POLR2A (NP_000928.1). |
Modifications | Unmodified |
Phospho-POLR2A-S2 Rabbit polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S2 of human POLR2A |
Modifications | Phospho S2 |
Phospho-POLR2A-S5 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S5 of human POLR2A |
Modifications | Phospho S5 |
Phospho-POLR2A-S7 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around of human Phospho-POLR2A-S7. |
Modifications | Phospho S7 |
POLR2A mouse monoclonal antibody,clone OTI1E5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
POLR2A mouse monoclonal antibody,clone OTI1E5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
POLR2A mouse monoclonal antibody,clone OTI2B7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
POLR2A mouse monoclonal antibody,clone OTI2B7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
POLR2A mouse monoclonal antibody,clone OTI3C8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
POLR2A mouse monoclonal antibody,clone OTI3C8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |