Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Lysozyme (LYZ) sheep polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Human Lysozyme. |
Lysozyme (LYZ) sheep polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Immunogen | Human Lysozyme. |
Lysozyme (LYZ) rabbit polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Canine, Feline, Human, Monkey, Porcine |
| Immunogen | Human Lysozyme purified from the urine of patients with monocytic leukemia. |
Rabbit Polyclonal Lysozyme Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LYZ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYZ antibody: synthetic peptide directed towards the C terminal of human LYZ. Synthetic peptide located within the following region: HLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQG |
Rabbit Polyclonal Anti-LYZ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYZ antibody: synthetic peptide directed towards the N terminal of human LYZ. Synthetic peptide located within the following region: CLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHL |
Anti-LYZ Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 19-148 amino acids of human lysozymelysozyme |
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
4 Weeks
USD 420.00
4 Weeks