Rabbit Polyclonal Anti-MCM7 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MCM7 |
Rabbit Polyclonal Anti-MCM7 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MCM7 |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
Applications | Assay, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit anti-MCM7 Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MCM7 |
Rabbit Polyclonal Anti-MCM7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MCM7 antibody: synthetic peptide directed towards the middle region of human MCM7. Synthetic peptide located within the following region: HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV |
Rabbit Polyclonal Anti-MCM7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MCM7 antibody: synthetic peptide directed towards the N terminal of human MCM7. Synthetic peptide located within the following region: MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYV |
Rabbit Polyclonal Anti-MCM7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MCM7 antibody: synthetic peptide directed towards the middle region of human MCM7. Synthetic peptide located within the following region: LSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVI |
Rabbit Polyclonal Anti-MCM7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MCM7 antibody is: synthetic peptide directed towards the N-terminal region of Human MCM7. Synthetic peptide located within the following region: KYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAV |
Anti-MCM7 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a C terminal 300 amino acids of human minichromosome maintenance complex component 7 |
MCM7 Rabbit polyclonal Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human MCM7 |
MCM7 Rabbit monoclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |