Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)

Applications IF, IHC, IP, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520)

Rabbit anti-CBS Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CBS

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

CBSL mouse monoclonal antibody, clone 3E1, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human, Rat

CBSL mouse monoclonal antibody, clone 6B8, Purified

Applications ELISA, IHC, WB
Reactivities Human

CBSL mouse monoclonal antibody, clone 6A9, Purified

Applications ELISA, IHC, WB
Reactivities Human

CBSL mouse monoclonal antibody, clone 5F7, Purified

Applications ELISA, IHC, WB
Reactivities Human

CBSL rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CBS

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CBS