Primary Antibodies

View as table Download

USD 320.00

In Stock

Goat Polyclonal Anti-Rab5a Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5a produced in E. coli.

USD 300.00

In Stock

Goat Polyclonal Anti-Rab5 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5a, Rab5b and rab5c produced in E. coli.

Rabbit anti-RAB5A Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RAB5A

Rabbit polyclonal Rab5 Antibody

Applications IF, WB
Reactivities Human, Mouse, Monkey, Bovine, Rat. Not tested in other species
Conjugation Unconjugated
Immunogen Human Rab5 synthetic peptide conjugated to KLH; identical to dog Rab5 sequence over the residues

Rabbit polyclonal Rab5 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Rab5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-211 amino acids from the C-terminal region of human Rab5.

Rabbit Polyclonal Anti-Rab5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rab5 Antibody: Peptide sequence around aa.188~192( N-P-G-A-N) derived from Human Rab5.

Rabbit Polyclonal Anti-Rab5A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rab5A Antibody: A synthesized peptide derived from human Rab5A

USD 320.00

In Stock

Goat Polyclonal Anti-Rab5a Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5a produced in E. coli.

Rabbit polyclonal Anti-RAB5A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS

Rabbit polyclonal Rab4 Antibody

Applications WB
Reactivities Human, Mouse, Rat. Not yet tested on other species
Conjugation Unconjugated
Immunogen C-terminal peptide from human Rab4

Rabbit polyclonal Anti-RAB5A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS

Carrier-free (BSA/glycerol-free) RAB5A mouse monoclonal antibody,clone OTI6D9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-RAB5A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-16 amino acids of Human Ras-related protein Rab-5A

Anti-RAB5A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-16 amino acids of Human Ras-related protein Rab-5A

Rab5 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Rab5

RAB5A mouse monoclonal antibody,clone OTI6D9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RAB5A mouse monoclonal antibody,clone OTI6D9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated