Primary Antibodies

View as table Download

Rabbit anti-RACGAP1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RACGAP1

Rabbit Polyclonal antibody to RACGAP1 (Rac GTPase activating protein 1)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 202 of RACGAP1 (Uniprot ID#Q9H0H5)

Goat Polyclonal Antibody against RACGAP1 / MgcRacGAP

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GRQGNFFASPMLK, from the C Terminus of the protein sequence according to NP_037409.1.

Rabbit Polyclonal Anti-Racgap1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Racgap1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Racgap1. Synthetic peptide located within the following region: GPVTTPEFQLVKTPSSNSLSQRLYNLSKSTPRFGNKSKSATNLGQQGKFF

Rabbit Polyclonal GTPase Activating Protein Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GTPase Activating Protein

Rabbit Polyclonal GTPase Activating Protein (Ser387) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GTPase Activating Protein around the phosphorylation site of Serine 387
Modifications Phospho-specific

Rabbit polyclonal GTPase Activating Protein antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RGAP1.

Rabbit Polyclonal Anti-RACGAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RACGAP1 antibody: synthetic peptide directed towards the N terminal of human RACGAP1. Synthetic peptide located within the following region: EILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALD

Rabbit Polyclonal Anti-RACGAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RACGAP1 antibody: synthetic peptide directed towards the N terminal of human RACGAP1. Synthetic peptide located within the following region: KREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQGNESIVAKTTVTVPNDGG

Rabbit Polyclonal Anti-CBFA2T2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBFA2T2 antibody: synthetic peptide directed towards the middle region of human CBFA2T2. Synthetic peptide located within the following region: GQGRPLLPVGRGSSARSADCSVPSPALDKTSATTSRSSTPASVTAIDTNG

Rabbit polyclonal anti-pS157 HsCyk-4 (MgcRacGAP and RacGAP1) antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen pS157 HsCyk-4 (MgcRacGAP and RacGAP1)