Primary Antibodies

View as table Download

Rabbit monoclonal anti-CATB antibody for SISCAPA, clone OTIR1C4

Applications SISCAPA
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-CTSL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CTSL

Rabbit polyclonal CATL1 (heavy chain, Cleaved-Thr288) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CATL1.

Rabbit Polyclonal Cathepsin B Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human NFkB p65 protein (between residues 200-270) [UniProt P07858]

Rabbit polyclonal antibody to Cathepsin S (cathepsin S)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 32 and 265 of Cathepsin S (Uniprot ID#P25774)

Rabbit Polyclonal Anti-CTSS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTSS antibody: synthetic peptide directed towards the N terminal of human CTSS. Synthetic peptide located within the following region: QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEH

Rabbit anti Legumain Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the internal sequence (a portion from 100aa-190aa) of human Legumain protein. This sequence is identical to mouse, human and rat.

Rabbit polyclonal anti-Cathepsin L antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 223 of human Cathepsin L

Rabbit Polyclonal Anti-LGMN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: KMVFYIEACESGSMMNHLPDNINVYATTAANPRESSYACYYDEKRSTYLG

Rabbit Polyclonal Anti-LGMN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: ESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTN

Carrier-free (BSA/glycerol-free) CTSL mouse monoclonal antibody,clone OTI2F1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTSL1 mouse monoclonal antibody,clone OTI2H2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTSL1 mouse monoclonal antibody,clone OTI6B8

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTSL1 mouse monoclonal antibody,clone OTI8C12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTSL1 mouse monoclonal antibody,clone OTI8H2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTSL mouse monoclonal antibody,clone OTI1C7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTSL mouse monoclonal antibody,clone OTI2C10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTSL mouse monoclonal antibody,clone OTI5A5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTSL mouse monoclonal antibody,clone OTI5C8

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTSL mouse monoclonal antibody,clone OTI6D5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-CTSB Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 80-333 amino acids of human cathepsin B

Anti-CTSB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 80-333 amino acids of human cathepsin B

CTSL1 mouse monoclonal antibody,clone OTI2H2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CTSL1 mouse monoclonal antibody,clone OTI2H2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CTSL mouse monoclonal antibody,clone OTI5C8

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated