DES rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DES |
DES rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DES |
Rabbit Polyclonal Anti-DES Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DES antibody: synthetic peptide directed towards the middle region of human DES. Synthetic peptide located within the following region: MALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKT |
Goat Anti-Desmin Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RDGEVVSEATQQQHE, from the C Terminus of the protein sequence according to NP_001918.3. |
Rabbit Polyclonal Anti-DES Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DES antibody: synthetic peptide directed towards the N terminal of human DES. Synthetic peptide located within the following region: PLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTR |
Rabbit Polyclonal Anti-Desmin Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Desmin Antibody: A synthesized peptide derived from human Desmin |
Rabbit polyclonal anti-Desmin antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Desmin. |
Rabbit anti Desmin Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-terminus of human Desmin. |
Rabbit anti Desmin (pT76/77)Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the N-terminus with a dual phosphorylated threonine (Thr76/Thr77) of human Desmin. |
Rabbit anti Desmin (Paired T76/77) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the N-terminus surrounding Threonine (Thr76/Thr77) without phosphorylation of human Desmin. |
Carrier-free (BSA/glycerol-free) DES mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Desmin mouse monoclonal antibody, clone OTI3B12
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Desmin mouse monoclonal antibody, clone OTI14E7
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Desmin mouse monoclonal antibody, clone OTI6H3
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal Desmin Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Desmin Mouse Monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
DES rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DES |
Desmin Rabbit polyclonal Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Desmin. AA range:421-470 |
DES (Desmin ) mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DES (Desmin ) mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Desmin mouse monoclonal antibody, clone OTI3B12
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Desmin mouse monoclonal antibody, clone OTI3B12
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Desmin mouse monoclonal antibody, clone OTI14E7
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Desmin mouse monoclonal antibody, clone OTI14E7
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Desmin mouse monoclonal antibody, clone OTI6H3
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Desmin mouse monoclonal antibody, clone OTI6H3
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Desmin mouse monoclonal antibody,clone UMAB166
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Desmin mouse monoclonal antibody,clone UMAB166
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Desmin mouse monoclonal antibody,clone UMAB166
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |