Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Rabbit Polyclonal Anti-Integrin aV Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin aV Antibody: A synthesized peptide derived from human Integrin aV |
Rabbit polyclonal ITGAV (heavy chain, Cleaved-Lys889) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human ITGAV. |
Rabbit Polyclonal Integrin alpha V Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Mouse Anti-Human CD51/CD61 (Integrin alpha v beta 3) Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ITGAV Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITGAV antibody is: synthetic peptide directed towards the C-terminal region of Human ITGAV. Synthetic peptide located within the following region: PVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENG |
Rat Anti-Mouse CD51 (Integrin alpha V) Purified (50 ug)
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Anti-ITGAV Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1021-1034 amino acids of human integrin, alpha V |
Rat monoclonal Anti-Integrin aVb6 Clone AvB6 53a.2
| Reactivities | Human |
| Conjugation | Unconjugated |
Rat monoclonal Anti-Integrin aVβ6 Clone Avβ6 62ow.17
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Integrin aV Clone P2W7
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse anti CD51 Monoclonal Antibody
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
ITGAV rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ITGAV |
Integrin alpha V Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Integrin alpha V |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- ITGAV
Conjugates
- Unconjugated
Filter by
Reactivities
Antibody Hosts
Clonalities
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (12)
- Cell adhesion molecules (CAMs) (12)
- Dilated cardiomyopathy (12)
- ECM-receptor interaction (12)
- Focal adhesion (12)
- Hypertrophic cardiomyopathy (HCM) (12)
- Pathways in cancer (12)
- Regulation of actin cytoskeleton (12)
- Small cell lung cancer (12)