Rabbit polyclonal antibody to ESE1 (E74-like factor 3 (ets domain transcription factor, epithelial-specific ))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 309 and 371 of ESE1 (Uniprot ID#P78545) |
Rabbit Polyclonal Anti-Elf3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Elf3 antibody: synthetic peptide directed towards the middle region of mouse Elf3. Synthetic peptide located within the following region: TATPQSSHASDSGGSDVDLDLTESKVFPRDGFPDYKKGEPKHGKRKRGRP |
Rabbit Polyclonal Anti-Elf3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Elf3 antibody: synthetic peptide directed towards the N terminal of mouse Elf3. Synthetic peptide located within the following region: MAATCEISNVFSNYFNAMYSSEDPTLAPAPPTTFGTEDLVLTLNNQQMTL |
Goat Polyclonal Antibody against ELF3 / ERT/ ESX
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SGWKEEEVLQSRN, from the C Terminus of the protein sequence according to NP_004424.2. |
Rabbit Polyclonal anti-Elf3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Elf3 antibody: synthetic peptide directed towards the middle region of human Elf3. Synthetic peptide located within the following region: GSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDG |
Rabbit Polyclonal Anti-ELF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELF3 antibody: synthetic peptide directed towards the middle region of human ELF3. Synthetic peptide located within the following region: PGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSD |
Rabbit Polyclonal Anti-Elf3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Elf3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TATPQSSHASDSGGSDVDLDLTESKVFPRDGFPDYKKGEPKHGKRKRGRP |
Carrier-free (BSA/glycerol-free) ELF3 mouse monoclonal antibody,clone OTI3F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELF3 mouse monoclonal antibody,clone OTI4H6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELF3 mouse monoclonal antibody,clone OTI5G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ELF3 mouse monoclonal antibody,clone OTI7H9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ELF3 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse ELF3 |
ELF3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ELF3 |
ESE1/ELF3 Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ESE1/ESE1/ELF3 (NP_004424.3). |
| Modifications | Unmodified |
ESE1/ELF3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ESE1/ESE1/ELF3 (NP_004424.3). |
| Modifications | Unmodified |
ELF3 mouse monoclonal antibody,clone OTI3F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ELF3 mouse monoclonal antibody,clone OTI3F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ELF3 mouse monoclonal antibody,clone OTI4H6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ELF3 mouse monoclonal antibody,clone OTI4H6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ELF3 mouse monoclonal antibody,clone OTI5G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ELF3 mouse monoclonal antibody,clone OTI5G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ELF3 mouse monoclonal antibody,clone OTI7H9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ELF3 mouse monoclonal antibody,clone OTI7H9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
