Primary Antibodies

View as table Download

IL-4 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI8D4

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700022

lL-10 Rat monoclonal antibody, ELISA and Luminex validated, clone OTI9D7

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700017

TNF-A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MAb1

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700026

CD40L Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MK13A4

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700027

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

Rabbit polyclonal anti-CD40 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human CD40.

Rabbit Polyclonal Anti-EPX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPX antibody: synthetic peptide directed towards the middle region of human EPX. Synthetic peptide located within the following region: LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDP

Anti-Human IL-5 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-5

Rabbit Polyclonal Anti-Interleukin 4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 4 Antibody: A synthesized peptide derived from human Interleukin 4

USD 320.00

In Stock

Goat Polyclonal Anti-IL10 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human IL10 produced in E. coli.

Rabbit polyclonal anti-IL-3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-3 antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-3 protein.

Mouse Anti-Human CD40 Purified (100 ug)

Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal IL-9 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-9 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human IL-9.

Anti-Human IL-4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-4

Anti-Human IL-10 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-10

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN

Rabbit Polyclonal Anti-CD40 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD

Rabbit Polyclonal Anti-CD40 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV

Rabbit Polyclonal Anti-Interleukin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5
TNF

USD 320.00

In Stock

Goat Polyclonal Anti-TNF alpha Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human TNF-_ produced in E. coli.
TNF

USD 470.00

In Stock

Mouse Monoclonal Anti-TNF Antibody, Biotinylated

Applications E
Reactivities Human, Monkey
Conjugation Biotin

Rabbit polyclonal anti-IL4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human IL4.

Mouse Anti-Human TNF alpha Purified (50 ug)

Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal IL4 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4.

Rabbit Polyclonal TNFA Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human TNFA

Anti-Human IL-9 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-9

Anti-Human IL-13 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-13

Anti-Human TNF-a Goat Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TNF-α

TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Eotaxin Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Eotaxin antibody was raised in rabbits against a peptide corresponding to amino acids near the carboxy terminus of human eotaxin.

Rabbit polyclonal anti-IL-4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human IL-4

Rabbit polyclonal TNF Alpha antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Rabbit polyclonal TNF alpha antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Mouse Anti-Human IL-4 Purified (50 ug)

Reactivities Human
Conjugation Unconjugated

Anti-Human IL-3 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-3

Anti-Human TNF-a Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TNF-α

Rabbit Polyclonal TNF-alpha Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]

Rabbit Polyclonal Anti-IL-13 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen For immunization recombinant human IL-13 (E.coli-derived) is used

TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Biotin

Applications ELISA
Reactivities Human
Conjugation Biotin

TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, HRP

Applications ELISA
Reactivities Human
Conjugation HRP

Rabbit polyclonal anti-CD40 antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues surrounding amino acids 261 of human CD40

Rabbit polyclonal anti-IL-3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human IL-3

Rabbit polyclonal anti-IL-4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.

Rabbit polyclonal IL-4 antibody Peroxidase Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.

Rabbit polyclonal IL-4 antibody Biotin Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.

Rabbit polyclonal anti-IL-10 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with human IL-10.

Rabbit polyclonal anti-IL-9 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein.

Rabbit polyclonal IL-9 antibody Peroxidase Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein.

Mouse Anti-Human CD154 (CD40 Ligand) Purified (25 ug)

Reactivities Human
Conjugation Unconjugated

Mouse Anti-Human TNF alpha Purified (50 ug)

Reactivities Human
Conjugation Unconjugated