Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NEU1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG

Rabbit polyclonal GC Antibody (Center)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 337-365 amino acids from the Central region of human GC.

Rabbit polyclonal antibody to beta-Gal (galactosidase, beta 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 166 and 677 of beta-Gal (Uniprot ID#P16278)

Rabbit Polyclonal antibody to GBA (glucosidase, beta, acid)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 352 and 536 of GBA (Uniprot ID#P04062)

Rabbit anti-GLB1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GLB1

Rabbit Polyclonal Antibody against FUCA2 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FUCA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 138-167 amino acids from the N-terminal region of human FUCA2.

Rabbit polyclonal antibody to beta-glucosidase (glucosidase, beta; acid (includes glucosylceramidase))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 65 and 384 of GBA (Uniprot ID#P04062)

Rabbit anti-HEXA Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HEXA

Rabbit polyclonal anti-HEXB antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HEXB.

Rabbit polyclonal anti-GLB1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GLB1.

Rabbit Polyclonal Anti-FUCA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FUCA1 Antibody: synthetic peptide directed towards the N terminal of human FUCA1. Synthetic peptide located within the following region: PSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLL

Rabbit Polyclonal Anti-HEXA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV

FUCA1 rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human FUCA1

HEXA rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human HEXA

AGA rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide directed towards the middle region of human AGA

GBA (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide directed towards the C-term region of human Glucosylceramidase

Rabbit Polyclonal Anti-FUCA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FUCA1 Antibody: synthetic peptide directed towards the middle region of human FUCA1. Synthetic peptide located within the following region: TNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPL

Rabbit Polyclonal Anti-FUCA2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Fuca2 antibody is: synthetic peptide directed towards the middle region of Mouse Fuca2. Synthetic peptide located within the following region: SKTLPELYELVNRYQPEVLWSDGDGGAPDHYWNSTGFLAWLYNESPVRKT

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI10B2 (formerly 10B2)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEU1 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEU1 mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEU1 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEU1 mouse monoclonal antibody, clone OTI3H4 (formerly 3H4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEU1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEU1 mouse monoclonal antibody, clone OTI3B8 (formerly 3B8)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEU1 mouse monoclonal antibody, clone OTI3C5 (formerly 3C5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GBA mouse monoclonal antibody, clone OTI1D12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GBA mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GBA mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GBA mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) GBA mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GBA mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-AGA Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 206-346 amino acids of human aspartylglucosaminidase

Anti-AGA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 206-346 amino acids of human aspartylglucosaminidase

Rabbit Polyclonal Anti-FUCA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FUCA1

AGA Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated

GLB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

GLB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

GLB1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

GLB1 mouse monoclonal antibody,clone 1C9, Biotinylated

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Biotin

GLB1 mouse monoclonal antibody,clone 1C9, HRP conjugated

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation HRP

GLB1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

GLB1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated