Mouse Monoclonal TLR9 Antibody (26C593.2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Canine, Equine, Primate |
Conjugation | Unconjugated |
Mouse Monoclonal TLR9 Antibody (26C593.2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Canine, Equine, Primate |
Conjugation | Unconjugated |
Mouse Monoclonal Beclin 1/ATG6 Antibody (9B6)
Applications | WB |
Reactivities | Human, Mouse, Rat, Bovine, Chicken, Equine, Porcin |
Conjugation | Unconjugated |
Rabbit Polyclonal MUC-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal SR1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Bovine, Canine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids 45-76 of human Sorcin was used as immunogen, GenBank no NP-003121. |
Doublecortin (DCX) mouse monoclonal antibody
Applications | IF, IHC, WB |
Reactivities | Bovine, Chicken, Equine, Human, Mouse, Porcine, Primate, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal beta-Arrestin 2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A peptide sequence corresponding to an area between amino acids 1 and 50 of human ARRB2 was used as the immunogen for the antibody, Gen Bank no. gb:ABG47460.1. |
Rabbit Polyclonal NFkB p65 NLS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Bovine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of the NFkB p65 NLS nuclear localization signal (NLS) (amino acids DTDDRHRIEEKRKRKT) was used as the immunogen for this antibody. |
Rabbit Polyclonal RUNX2/CBFA1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Chicken, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to somewhere between amino acids 250-300 of human RUNX2 was used as immunogen for this antibody.RUNX2 and RUNX1 share an approximate 66% homology in peptide sequence used as immunogen. |
Rabbit Polyclonal CXCR7/RDC-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1. |
Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody
Applications | IHC, WB |
Reactivities | Human, Amphibian, Bovine, Canine, Equine, Opossum |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody. |
Mouse Monoclonal Cytochrome c Antibody (7H8.2C12)
Applications | WB |
Reactivities | Human, Mouse, Canine, Drosophila, Equine, Mammalian |
Conjugation | Unconjugated |
Rabbit Polyclonal SUMO3 Antibody
Applications | WB |
Reactivities | Equine, Human, Mouse, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 50-95 of human SUMO3 (SMT3) was used as the immunogen for this antibody. |
Rabbit Polyclonal Snail Antibody
Applications | WB |
Reactivities | Human, Mouse, Canine, Equine |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 80-130 of human SNAI1 was used as the immunogen |