Primary Antibodies

View as table Download

Rabbit anti-RAD17 Polyclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human RAD17

Rabbit Polyclonal Anti-RAD17 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD17 Antibody: A synthesized peptide derived from human RAD17

Rabbit polyclonal RAD17 (Ab-646) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human RAD17.

Rabbit Polyclonal Rad17 [p Ser645] Antibody

Applications IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A portion of human Rad17 protein containing a phosphorylated serine residue at position 645 was used as the immunogen.

Rabbit Polyclonal anti-RAD17 antibody

Applications WB
Reactivities Human, Mouse, Xenopus
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the C terminal of human RAD17. Synthetic peptide located within the following region: PTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT

Rabbit Polyclonal anti-RAD17 antibody

Applications WB
Reactivities Human, Mouse, Xenopus
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the N terminal of human RAD17. Synthetic peptide located within the following region: MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF

Rabbit Polyclonal Rad17 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to a N-terminal region of human RAD17.

Rabbit Polyclonal Anti-RAD17 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RAD17