Germany
Japan
United Kingdom
China
c Abl (ABL1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Primary Antibodies
View as table Download
FYN rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
PKC alpha (PRKCA) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Rabbit polyclonal Rock-2 phospho Y256 antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding Y256 of human ROCK-2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal c-Abl Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Abl |
Rabbit polyclonal Anti-FYN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FYN antibody: synthetic peptide directed towards the N terminal of human FYN. Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN |
Rabbit polyclonal Anti-FYN Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FYN antibody: synthetic peptide directed towards the middle region of human FYN. Synthetic peptide located within the following region: CPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGEN |
Mouse Monoclonal cleaved ROCK1 Antibody (154C1465)
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Canine, Primate, Rabbit |
| Conjugation | Unconjugated |
Rabbit anti Rho Kinase/ROCKII (pT396) Polyclonal Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope -VETFP- with a single phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine. |
Rabbit anti Rho Kinase/ROCKII (Paired T396) Polyclonal Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope -VETFP- without a phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine. |
Rabbit anti Rho Kinase/ROCKII (IN) Polyclonal Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide (19mer) derived from 250-350 amino acids of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine. |
Rabbit anti Rho Kinase/ROCKII (pT249) Polyclonal Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope -CDTAV- with a single phosphorylation site Thr249 of human Rho Kinase/RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine. |
Rabbit anti Rho Kinase/ROCKII (Paired T249) Polyclonal Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope -CDTAV- without a phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine. |
Anti-PRKCA rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha |
Anti-ROCK1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1115-1354 amino acids of human Rho-associated, coiled-coil containing protein kinase 1 |
Anti-ROCK2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human Rho-associated, coiled-coil containing protein kinase 2 |
Rabbit Polyclonal Anti-KYNU Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FYN |
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
Active filters
Families
- Protein Kinase
Pathways
- Pathogenic Escherichia coli infection