Germany
Japan
United Kingdom
China
Primary Antibodies
Download
USD 250.00
2 Weeks
Tubulin (TUBA1B) (Tyr-Tubulin) rat monoclonal antibody, clone YL1/2, Purified
| Applications | ELISA, IF, IHC, IP, R, WB |
| Reactivities | Birds, Mammalian, Yeast |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit Polyclonal Anti-TUBA4A Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE |
Chicken polyclonal anti-TUBA1A(alpha Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Tubulin antibody was raised against a 16 amino acid peptide near the amino terminus of human Tubulin. |
Rabbit Polyclonal Anti-NCL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCL antibody: synthetic peptide directed towards the N terminal of human NCL. Synthetic peptide located within the following region: GKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDED |
Rabbit Polyclonal Anti-NCL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCL antibody: synthetic peptide directed towards the C terminal of human NCL. Synthetic peptide located within the following region: GGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE |
Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
| Applications | IHC, WB |
| Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
| Conjugation | Unconjugated |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
USD 420.00
In Stock
USD 340.00
2 Weeks
Rabbit Polyclonal Anti-TUBB2A Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the N terminal of human TUBB2A. Synthetic peptide located within the following region: MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV |
Mouse Monoclonal beta Tubulin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Anti-CDH1 (aa662-675) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDH1 (aa662-675) Antibody: Peptide with sequence C-DYKINLKLMDNQNK, from the internal region of the protein sequence according to NP_004351.1. |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CDH1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified Recombinant peptide derived from within residues 601 to 701 of human CDH1 produced in E. coli. |
Rabbit Polyclonal antibody to beta Tubulin (tubulin, beta)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 238 and 429 of beta Tubulin |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit Polyclonal Anti-TUBB2A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the middle region of human TUBB2A. Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC |
Active filters
Pathways
- Pathogenic Escherichia coli infection
Filter by
Target Symbol
- CTNNB1 (162)
- CDH1 (69)
- KRT18 (68)
- TUBAL3 (50)
- CD14 (47)
- ACTB (38)
- SHC1 (32)
- TUBB2B (32)
- TUBB4A (32)
- TUBA8 (31)
- EZR (29)
- ITGB1 (27)
- PRKCA (27)
- ABL1 (21)
- WASL (21)
- TUBA1A (20)
- TUBA1B (20)
- TLR4 (17)
- CTTN (16)
- YWHAZ (16)
- ROCK2 (15)
- TUBA3E (15)
- TUBB1 (15)
- TUBB2A (15)
- FYN (12)
- NCF1 (12)
- TUBB (12)
- TUBB3 (12)
- ARHGEF2 (11)
- CLDN1 (11)
- TUBA4A (11)
- RHOA (9)
- YWHAQ (9)
- HCLS1 (8)
- TLR5 (8)
- TUBA1C (8)
- ACTG1 (7)
- LY96 (7)
- NCK2 (7)
- NCL (7)
- ROCK1 (7)
- ARPC1A (5)
- ARPC3 (5)
- ARPC5 (5)
- CDC42 (5)
- TUBA3C (5)
- WAS (5)
- ARPC1B (4)
- ARPC2 (4)
- NCK1 (4)
- ARPC4 (2)
- TUBA3D (2)
- TUBB6 (2)
- PARVG (1)
- TUBB4Q (1)
- TUBB8 (1)
Reactivities
- Human (906)
- Mouse (680)
- Rat (619)
- Monkey (161)
- Dog (127)
- Bovine (24)
- Chicken (20)
- Canine (15)
- Pig (14)
- Rabbit (9)
- Cow (8)
- Xenopus (7)
- Canis (6)
- Hamster (6)
- Rhesus Monkey (6)
- Zebrafish (6)
- Drosophila (5)
- Porcine (5)
- Chimpanzee (4)
- Primate (4)
- All Species (3)
- Dictyostelium (2)
- Goat (2)
- Guinea Pig (2)
- Sheep (2)
- X. tropicalis (2)
- Avian (1)
- Bat (1)
- Broad (1)
- Chlamydomonas (1)
- Feline (1)
- Fish (1)
- Horse (1)
- Mammalian (1)
- Squirrel (1)
- Yeast (1)