Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-Cytochrome P450 2J2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 2J2 Antibody: A synthesized peptide derived from human Cytochrome P450 2J2

Rabbit Polyclonal Anti-Phospho-ALOX5(Ser523) Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-ALOX5(Ser523) Antibody: A synthesized peptide derived from human ALOX5 around the phosphorylation site of Sersine 523
Modifications Phospho-specific

Goat Polyclonal Antibody against COX1 / PTGS1

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QDDGPAVERPSTEL, from the C Terminus of the protein sequence according to NP_000953.2; NP_542158.1.

Goat Polyclonal Antibody against PTGS2

Applications FC, IF, WB
Reactivities Human
Immunogen Peptide with sequence C-NPTVLLKERSTEL, from the C Terminus of the protein sequence according to NP_000954.1.

Goat Anti-ALOX15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HYKTDVAVKDDPE, from the internal region of the protein sequence according to NP_001131.3.

Rabbit polyclonal antibody to Cytochrome P450 4A11 (cytochrome P450, family 4, subfamily A, polypeptide 11)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 48 and 316 of CYP4A11 (Uniprot ID#Q02928)

Rabbit polyclonal Cytochrome P450 2B6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2B6.
Modifications Phospho-specific

Rabbit polyclonal Cytochrome P450 2B6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Cytochrome P450 2B6.
Modifications Phospho-specific

Rabbit polyclonal Cytochrome P450 2C8 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8.
Modifications Phospho-specific

Rabbit polyclonal anti-THAS antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human THAS.

Rabbit polyclonal Cytochrome P450 2J2 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from inetrnal of human Cytochrome P450 2J2.

Rabbit polyclonal Cytochrome P450 2C8/9/18/19 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8/9/18/19.

Rabbit polyclonal Cytochrome P450 4A11/22 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CYTOCHROME P450 4A11/22.

Rabbit polyclonal Gamma-glutamyltransferase 4 (heavy chain, Cleaved-Thr472) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Gamma-glutamyltransferase 4.

Rabbit polyclonal Cytochrome P450 4F2 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human Cytochrome P450 4F2.

Rabbit polyclonal Cytochrome P450 2U1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2U1.

Rabbit polyclonal anti-Cox-3 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide mapping to the N-terminus of mouse Cox-3

Anti-GGT1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human gamma-glutamyltransferase 1

Rabbit polyclonal AKR1C3 Antibody (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This AKR1C3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 107-135 amino acids from the Central region of human AKR1C3.

Rabbit polyclonal CYP2E1 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CYP2E1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 402-429 amino acids from the C-terminal region of human CYP2E1.

Rabbit Polyclonal Cox1 (PTGS1) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Cox1

Rabbit Polyclonal Cox2 (PTGS2) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Cox2

Rabbit Polyclonal c-PLA2 (Ser505) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-PLA2 around the phosphorylation site of Serine 505
Modifications Phospho-specific

Rabbit polyclonal ALOX5 (Phospho-Ser523) antibody

Applications WB
Reactivities Human: Ser524, Rat: Ser523
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ALOX5 around the phosphorylation site of serine523.
Modifications Phospho-specific

Rabbit Polyclonal Anti-PLA2G4E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G4E antibody: synthetic peptide directed towards the c terminal of human PLA2G4E. Synthetic peptide located within the following region: TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT

Rabbit Polyclonal COX2 Antibody

Applications ELISA
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Cytochrome P450 2E1 (CYP2E1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Canine, Human, Mouse, Rat
Immunogen Synthetic peptide surrounding amino acid 405 of Human Cytochrome P450.

PTGS1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence near the N-terminal of human PTGS1(COX1)

Cytochrome P450 2E1 (CYP2E1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide mapping at the C-terminal of human P450ⅡE1

COX2 (PTGS2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of Human COX-2

Goat Polyclonal Antibody against Arachidonate 5-lipoxygenase

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-ERNKKKQLPYYYLSPD, from the C Terminus of the protein sequence according to NP_000689.1.

Goat Polyclonal Antibody against GPX2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SLDGEKVDFN, from the internal region of the protein sequence according to NP_002074.2.

Goat Polyclonal Antibody against GPX1

Applications IHC, WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence C-REALPAPSDDATA, from the internal region of the protein sequence according to NP_000572.2.

Rabbit polyclonal antibody to Glutathione peroxidase 7 (glutathione peroxidase 7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 187 of GPX7 (Uniprot ID#Q96SL4)

Rabbit Polyclonal antibody to GGT1 (gamma-glutamyltransferase 1)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 226 of GGT1 (Uniprot ID#P19440)

Rabbit polyclonal antibody to Phospholipase A2 XIIA (phospholipase A2, group XIIA)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 22 and 115 of PLA2G12A (Uniprot ID#Q9BZM1)

Rabbit anti-AKR1C3 polyclonal antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH

Rabbit polyclonal anti-Cox1/PTGS1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human COX1.
Modifications Phospho-specific

Rabbit polyclonal anti-CBR3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CBR3.

PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Chicken, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit, Rat, Zebrafish
Conjugation Unconjugated
Immunogen PGES / PTGES antibody was raised against synthetic 14 amino acid peptide from near N-terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Rat, Bovine, Dog, Elephant, Panda, Rabbit, Horse, Pig, Opossum, Turkey, Chicken, Platypus, Pufferfish, Zebrafish, Stickleback (100%); Mouse, Xenopus, Pike (93%).

Rabbit Polyclonal Cox1 (PTGS1) Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Cox1.

Rabbit polyclonal Anti-LTC4S Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the N terminal of human LTC4S. Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY

Rabbit Polyclonal Anti-TBXAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: GYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLP

Rabbit Polyclonal Anti-CYP2J2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2J2 antibody: synthetic peptide directed towards the C terminal of human CYP2J2. Synthetic peptide located within the following region: EKVQAEIDRVIGQGQQPSTAARESMPYTNAVIHEVQRMGNIIPLNVPREV

Rabbit Polyclonal Antibody against PTGDS

Applications WB
Reactivities Human, Feline, Bovine, Rabbit, Dog, Rat, Mouse, Primate
Conjugation Unconjugated
Immunogen The epitope recognized by this antibody maps to region within residue 120-190 of human PTGDS. [Swiss-Prot# P41222]

Goat Polyclonal Antibody against PLA2G1B

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence NKAHKNLDTKKYCQS, from the C Terminus of the protein sequence according to NP_000919.1.

Goat Polyclonal Antibody against AKR1C3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CFASHPNYPYSDEY, from the C Terminus of the protein sequence according to NP_003730.

Goat Polyclonal Antibody against GPX7

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CNQFGQQEPDSNK, from the internal region of the protein sequence according to NP_056511.2.

Rabbit polyclonal antibody to PTGES2 (prostaglandin E synthase 2)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 106 and 343 of PTGES2 (Uniprot ID#Q9H7Z7)

Rabbit Anti-5-Lipoxygenase (Ser523) Antibody (Phospho-Specific)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser523 conjugated to KLH
Modifications Phospho-specific