Germany
Japan
United Kingdom
China
MMP1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MMP1 |
Primary Antibodies
View as table Download
FABP2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FABP2 |
Rabbit anti-NR1H3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NR1H3 |
Rabbit anti-PLTP Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PLTP |
Rabbit Polyclonal Anti-RXRG Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRG antibody: synthetic peptide directed towards the C terminal of human RXRG. Synthetic peptide located within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT |
Rabbit Polyclonal Anti-ACSL6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACSL6 antibody is: synthetic peptide directed towards the middle region of Human ACSL6. Synthetic peptide located within the following region: GPGAIRYIINTADISTVIVDKPQKAVLLLEHVERKETPGLKLIILMDPFE |
Rabbit Polyclonal Anti-PPARG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARG antibody: synthetic peptide directed towards the N terminal of human PPARG. Synthetic peptide located within the following region: MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDL |
Rabbit Polyclonal Anti-RXRB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRB antibody: synthetic peptide directed towards the C terminal of human RXRB. Synthetic peptide located within the following region: AKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIG |
Rabbit Polyclonal Anti-HMGCS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMGCS2 antibody: synthetic peptide directed towards the N terminal of human HMGCS2. Synthetic peptide located within the following region: PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE |
Rabbit Polyclonal Anti-SLC27A5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC27A5 antibody: synthetic peptide directed towards the middle region of human SLC27A5. Synthetic peptide located within the following region: KLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVD |
Rabbit Polyclonal Anti-ACSL6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACSL6 antibody is: synthetic peptide directed towards the C-terminal region of Human ACSL6. Synthetic peptide located within the following region: SGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYS |
Rabbit Polyclonal Anti-CYP4A22 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: AQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERVKTFPS |
Rabbit Polyclonal Anti-PLIN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLIN antibody: synthetic peptide directed towards the N terminal of human PLIN. Synthetic peptide located within the following region: STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS |
Rabbit Polyclonal Anti-GK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GK2 Antibody: A synthesized peptide derived from human GK2 |
Rabbit Polyclonal Anti-GK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GK Antibody: A synthesized peptide derived from human GK |
Apolipoprotein A II (APOA2) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Human Apo AII |
Goat Polyclonal Antibody against FABP2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EGVEAKRIFKKD, from the C Terminus of the protein sequence according to NP_000125.1. |
Goat Polyclonal Antibody against RXRA
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CQVNSSLTSPTGRGSM, from the internal region of the protein sequence according to NP_002948.1. |
Goat Polyclonal Antibody against UCP1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EQLKRELSKSRQ, from the C Terminus of the protein sequence according to NP_068605.1. |
Goat Polyclonal Antibody against PCK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EKEVEDIEKYLEDQ, from the internal region (near the C Terminus) of the protein sequence according to NP_002582.2. |
Rabbit Polyclonal Adiponectin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Adiponectin antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human adiponectin. The immunogen is located within the last 50 amino acids of Adiponectin. |
Rabbit polyclonal antibody to Cytochrome P450 4A11 (cytochrome P450, family 4, subfamily A, polypeptide 11)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 48 and 316 of CYP4A11 (Uniprot ID#Q02928) |
Rabbit polyclonal anti-ME1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ME1. |
Rabbit polyclonal PDK1 (Tyr9) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PDK1 around the phosphorylation site of tyrosine 9 (Q-L-YP-D-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-Glycerol Kinase / GLPK3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLPK3. |
Rabbit polyclonal ILK (Ser246) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ILK around the phosphorylation site of serine 246 (I-F-SP-H-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-APOA5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APOA5. |
Rabbit polyclonal MMP1 (Cleaved-Phe100) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP1. |
Rabbit polyclonal Cytochrome P450 4A11/22 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CYTOCHROME P450 4A11/22. |
Rabbit polyclonal Cytochrome P450 27A1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 27A1. |
Rabbit polyclonal anti-GLPK2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLPK2. |
Rabbit polyclonal anti-LOX-1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide near the N-terminus of human Lox-1 |
Rabbit polyclonal anti-FABP5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant human FABP-5 |
Anti-PPARA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-18 amino acids of human peroxisome proliferator-activated receptor alpha |
Rabbit polyclonal MMP1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MMP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 317-347 amino acids from the Central region of human MMP1. |
Rabbit polyclonal FADS2 Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FADS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 96-122 amino acids from the Central region of human FADS2. |
Rabbit polyclonal CYP8B1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP8B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 471-501 amino acids from the C-terminal region of human CYP8B1. |
Rabbit Polyclonal PDK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDK1 |
Rabbit Polyclonal PDK1 (Ser241) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDK1 around the phosphorylation site of Serine 241 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PPAR-gamma Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR-gamma |
Rabbit Polyclonal Anti-ACSL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the N terminal of human ACSL1. Synthetic peptide located within the following region: ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY |
Rabbit Polyclonal Anti-ACADM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACADM antibody: synthetic peptide directed towards the N terminal of human ACADM. Synthetic peptide located within the following region: ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG |
Active filters
Isotypes
- IgG
Pathways
- PPAR signaling pathway
Filter by
Category
Target Symbol
- PPARG (12)
- MMP1 (10)
- NR1H3 (9)
- PCK1 (9)
- PDPK1 (9)
- PPARD (9)
- PPARA (8)
- ME1 (7)
- PLIN1 (7)
- FABP4 (6)
- RXRA (6)
- RXRB (6)
- RXRG (6)
- ACOX2 (5)
- APOA1 (5)
- CPT1A (5)
- FABP1 (5)
- FABP2 (5)
- GK (5)
- GK2 (5)
- ILK (5)
- OLR1 (5)
- ACADM (4)
- ACOX3 (4)
- ADIPOQ (4)
- ANGPTL4 (4)
- CD36 (4)
- FABP3 (4)
- FABP7 (4)
- SCD (4)
- ACADL (3)
- ACSL1 (3)
- ACSL4 (3)
- ACSL5 (3)
- ACSL6 (3)
- APOA5 (3)
- CPT1B (3)
- CYP27A1 (3)
- CYP4A11 (3)
- CYP8B1 (3)
- FABP5 (3)
- HMGCS2 (3)
- PLTP (3)
- SCP2 (3)
- SLC27A4 (3)
- SLC27A5 (3)
- UCP1 (3)
- ACOX1 (2)
- APOA2 (2)
- AQP7 (2)
- CPT2 (2)
- CYP4A22 (2)
- DBI (2)
- EHHADH (2)
- FABP6 (2)
- PCK2 (2)
- SLC27A1 (2)
- SLC27A2 (2)
- SLC27A6 (2)
- SORBS1 (2)
- UBC (2)
- ACAA1 (1)
- ACSL3 (1)
- CYP7A1 (1)
- FADS2 (1)
- LPL (1)
- SCD5 (1)