Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346) |
Rabbit monoclonal anti-FABP4 antibody for SISCAPA, clone OTIR5E9
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-CD36 mouse mAb, clone OTI4H7, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Anti-CD36 mouse mAb, clone OTI3F4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Anti-CD36 mouse mAb, clone OTI3F4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Anti-CD36 mouse mAb, clone OTI4H7, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Rabbit anti-DBI Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DBI |
Perilipin-1 (PLIN1) mouse monoclonal antibody, clone PERI112.17, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
Rabbit Polyclonal Anti-ACSL3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI |
Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4). |
Rabbit Polyclonal Anti-ACAA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD |
Rabbit Polyclonal PPARG Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARG antibody: human PPARG (peroxisome proliferator-activated receptor gamma), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein. |
Rabbit polyclonal anti-Perilipin A antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 510 of mouse Perilipin A. |
SCD5 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 147-175 amino acids from the Central region of Human SCD5 |
Rabbit polyclonal anti-MMP-1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-1 antibody. |
Rabbit Polyclonal Anti-CYP4A22 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ |
Mouse monoclonal anti-FABP4 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
BLBP (FABP7) mouse monoclonal antibody, clone AT1D1, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
PCK1 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PCK1 |
Rabbit Polyclonal Anti-SCD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCD antibody: synthetic peptide directed towards the middle region of human SCD. Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG |
Rabbit Polyclonal Anti-RXRA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
Rabbit anti-PPARD Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPARD |
Rabbit Polyclonal Anti-CPT1B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPT1B antibody: synthetic peptide directed towards the middle region of human CPT1B. Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA |
Rabbit Polyclonal Anti-MMP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP1 Antibody: A synthesized peptide derived from human MMP1 |
BLBP (FABP7) mouse monoclonal antibody, clone AT1D1, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
SCD1 (SCD) mouse monoclonal antibody, clone CD.E10, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human, Mouse |
Active filters
Pathways
- PPAR signaling pathway
Filter by
Category
Target Symbol
- ADIPOQ (111)
- LPL (61)
- PPARA (45)
- APOA5 (39)
- CD36 (32)
- SCP2 (24)
- ACSL5 (23)
- PPARD (21)
- ACADM (20)
- NR1H3 (20)
- DBI (18)
- FABP2 (16)
- CPT1B (15)
- PPARG (15)
- FABP3 (14)
- MMP1 (14)
- PLIN1 (13)
- APOA1 (11)
- ILK (11)
- FABP7 (10)
- PCK1 (10)
- PDPK1 (9)
- EHHADH (8)
- FABP4 (8)
- ME1 (8)
- SCD (8)
- FABP1 (7)
- OLR1 (7)
- RXRB (7)
- RXRG (7)
- ACAA1 (6)
- ACOX2 (6)
- ANGPTL4 (6)
- CPT1A (6)
- GK (6)
- RXRA (6)
- APOA2 (5)
- GK2 (5)
- UCP1 (5)
- ACOX3 (4)
- ACSL1 (4)
- ACSL4 (4)
- CYP27A1 (4)
- CYP4A11 (4)
- CYP8B1 (4)
- HMGCS2 (4)
- PLTP (4)
- ACADL (3)
- ACSL6 (3)
- CPT1C (3)
- CPT2 (3)
- FABP5 (3)
- SCD5 (3)
- SLC27A4 (3)
- SLC27A5 (3)
- ACOX1 (2)
- ACSL3 (2)
- AQP7 (2)
- CYP4A22 (2)
- FABP6 (2)
- FADS2 (2)
- PCK2 (2)
- SLC27A1 (2)
- SLC27A2 (2)
- SLC27A6 (2)
- SORBS1 (2)
- UBC (2)
- APOC3 (1)
- CYP7A1 (1)