Goat Polyclonal Anti-CD2 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant peptide derived from within residues 300 aa to the C-terminus of human CD2 produced in E. coli. |
Goat Polyclonal Anti-CD2 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant peptide derived from within residues 300 aa to the C-terminus of human CD2 produced in E. coli. |
Rabbit polyclonal CSFR (Tyr708) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human: Tyr708, Mouse: Tyr706, Rat: Tyr706 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CSF1R around the phosphorylation site of tyrosine 708. |
Modifications | Phospho-specific |
Rabbit polyclonal MME Antibody (Center)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 274-302 amino acids from the Central region of human MME. |
Rabbit Polyclonal CD44 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 |
Rabbit Polyclonal M-CSF Receptor Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human M-CSF Receptor |
Rabbit Polyclonal M-CSF Receptor (Tyr809) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human M-CSF Receptor around the phosphorylation site of Tyrosine 809 |
Modifications | Phospho-specific |
Rabbit Polyclonal Integrin beta3 (Tyr773) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 773 |
Modifications | Phospho-specific |
Rabbit Polyclonal Integrin beta3 (Tyr785) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 785 |
Modifications | Phospho-specific |
Rabbit Polyclonal Epo-R Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Epo-R |
Rabbit Polyclonal Phospho-Epo-R (Tyr368) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Epo-R around the phosphorylation site of Tyrosine 368 |
Modifications | Phospho-specific |
Rabbit Polyclonal TNFA Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit Polyclonal Phospho-c-Kit (Tyr721) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human c-Kit around the phosphorylation site of Tyrosine 721. |
Modifications | Phospho-specific |
Rabbit Polyclonal EPO Receptor Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human EPO receptor protein (between residues 300-400) [UniProt P19235] |
CD36 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI6A5
Applications | ELISA, LMNX |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700031 |
Rabbit Polyclonal Integrin alpha 4 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Integrin alpha 4 antibody was raised against a 16 amino acid peptide from near the center of human Integrin alpha 4. |
Rabbit polyclonal Epo-R (Ab-426) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Epo-R. |
Rabbit Polyclonal CD33 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CD33 antibody was raised against a 14 amino acid synthetic peptide near the center of human CD33. |
Anti-CD3D Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 22-105 amino acids of human CD3d molecule, delta (CD3-TCR complex) |
Rabbit Polyclonal Integrin beta3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 |
Rabbit Polyclonal c-Kit Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Kit |
Rabbit Polyclonal TNF-alpha Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375] |
Rabbit Polyclonal Integrin alpha 4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Integrin alpha 4 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human Integrin alpha 4. |
Rabbit polyclonal antibody to CD42c (glycoprotein Ib (platelet), beta polypeptide)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 56 and 148 of CD42c (Uniprot ID#P13224) |
Goat Anti-CSF1R (aa 700-710) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KNIHLEKKYVR, from the internal region of the protein sequence according to NP_005202.2. |
Rabbit polyclonal anti-IL-7 antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | E. coli expressed rat IL-7 |
Anti-CD3E Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.197~201( D-L-Y-S-G) derived from Human CD3E. |
Anti-CD1D Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 20-190 amino acids of human CD1d molecule |
Anti-CD34 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.377~381(Q-H-V-V-A) derived from Human CD34. |
Anti-KIT Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.719~723 (N-E-Y-M-D) derived from Human c-Kit. |
Rabbit anti-CD33 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD33 |
EPOR Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human EPOR |
Phospho-KIT-Y721 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y721 of human KIT |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-KITLG Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KITLG antibody: synthetic peptide directed towards the middle region of human KITLG. Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG |
Goat Anti-CD3E (cytoplasmic) Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RKGQRDLYSGLNQR, from the internal region of the protein sequence according to NP_000724.1. |
Goat Anti-CD3G Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QDGVRQSRASDKQT, from the internal region of the protein sequence according to NP_000064.1. |
Mouse monoclonal Anti-CD3 Clone PC3/188A
Reactivities | Bovine, Chicken, Guinea Pig, Opossum, Primate, Rabbit, Rat, Pig, Horse |
Conjugation | Unconjugated |
Mouse monoclonal Anti-Leu1 Clone CD5/54/F6
Reactivities | Bovine, Chicken, Guinea Pig, Opossum, Primate, Rabbit, Rat, Pig, Horse |
Conjugation | Unconjugated |
Mouse monoclonal Anti-Integrin b3 Clone F11
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Mouse monoclonal Anti-Integrin b3 Clone MHF4
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit anti CD117 (kit) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rokhlin OW, et al. a prostate-specific surface-reactive monoclonal antibody. Cancer Lett. 131: 129-136, 1998. |
Rabbit anti CSF-1R (pY723) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the epitope –DTYVEM- at a phosphorylation site at tyrosine 723 of human CSF-1R protein. This sequence is identical within human, mouse, rat, and bovine. |
Rabbit anti CSF-1R (Paired Y723) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the epitope –DTYVEM- without a phosphorylation site at tyrosine 723 of human CSF-1R protein. This sequence is identical within human, mouse, rat, and bovine. |
Rabbit anti CSF-1R Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-terminus of human CSF-1R protein. This sequence is identical within human, mouse, rat, and bovine. |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody, clone OTI10B5 (formerly 10B5)
Applications | WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody, clone OTI9C1 (formerly 9C1)
Applications | WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody, clone OTI18E3 (formerly 18E3)
Applications | FC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI6A5 (formerly 6A5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MME mouse monoclonal antibody, clone OTI3D11 (formerly 3D11)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |