Germany
Japan
United Kingdom
China
Goat Polyclonal Anti-CD2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant peptide derived from within residues 300 aa to the C-terminus of human CD2 produced in E. coli. |
Primary Antibodies
View as table Download
Rabbit polyclonal CSFR (Tyr708) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human: Tyr708, Mouse: Tyr706, Rat: Tyr706 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CSF1R around the phosphorylation site of tyrosine 708. |
| Modifications | Phospho-specific |
Rabbit polyclonal MME Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 274-302 amino acids from the Central region of human MME. |
Rabbit Polyclonal CD44 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 |
Rabbit Polyclonal M-CSF Receptor Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human M-CSF Receptor |
Rabbit Polyclonal M-CSF Receptor (Tyr809) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human M-CSF Receptor around the phosphorylation site of Tyrosine 809 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Integrin beta3 (Tyr773) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 773 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Integrin beta3 (Tyr785) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 785 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Epo-R Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Epo-R |
Rabbit Polyclonal Phospho-Epo-R (Tyr368) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Epo-R around the phosphorylation site of Tyrosine 368 |
| Modifications | Phospho-specific |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit Polyclonal Phospho-c-Kit (Tyr721) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human c-Kit around the phosphorylation site of Tyrosine 721. |
| Modifications | Phospho-specific |
Rabbit polyclonal Epo-R (Ab-426) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Epo-R. |
Rabbit Polyclonal CD33 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CD33 antibody was raised against a 14 amino acid synthetic peptide near the center of human CD33. |
Anti-CD3D Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 22-105 amino acids of human CD3d molecule, delta (CD3-TCR complex) |
Rabbit Polyclonal Integrin beta3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Integrin beta3 |
Rabbit Polyclonal c-Kit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Kit |
Rabbit Polyclonal Integrin alpha 4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Integrin alpha 4 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human Integrin alpha 4. |
Rabbit polyclonal antibody to CD42c (glycoprotein Ib (platelet), beta polypeptide)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 56 and 148 of CD42c (Uniprot ID#P13224) |
Goat Anti-CSF1R (aa 700-710) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KNIHLEKKYVR, from the internal region of the protein sequence according to NP_005202.2. |
Rabbit polyclonal anti-IL-7 antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed rat IL-7 |
Anti-CD3E Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.197~201( D-L-Y-S-G) derived from Human CD3E. |
Anti-CD1D Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 20-190 amino acids of human CD1d molecule |
Anti-CD34 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.377~381(Q-H-V-V-A) derived from Human CD34. |
Anti-KIT Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.719~723 (N-E-Y-M-D) derived from Human c-Kit. |
Rabbit anti-CD33 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD33 |
EPOR Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human EPOR |
Phospho-KIT-Y721 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y721 of human KIT |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-KITLG Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KITLG antibody: synthetic peptide directed towards the middle region of human KITLG. Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG |
Goat Anti-CD3E (cytoplasmic) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RKGQRDLYSGLNQR, from the internal region of the protein sequence according to NP_000724.1. |
Goat Anti-CD3G Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QDGVRQSRASDKQT, from the internal region of the protein sequence according to NP_000064.1. |
Mouse monoclonal Anti-CD3 Clone PC3/188A
| Reactivities | Bovine, Chicken, Guinea Pig, Opossum, Primate, Rabbit, Rat, Pig, Horse |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Leu1 Clone CD5/54/F6
| Reactivities | Bovine, Chicken, Guinea Pig, Opossum, Primate, Rabbit, Rat, Pig, Horse |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Integrin b3 Clone F11
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Integrin b3 Clone MHF4
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Rabbit anti CD117 (kit) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rokhlin OW, et al. a prostate-specific surface-reactive monoclonal antibody. Cancer Lett. 131: 129-136, 1998. |
Rabbit anti CSF-1R (pY723) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope –DTYVEM- at a phosphorylation site at tyrosine 723 of human CSF-1R protein. This sequence is identical within human, mouse, rat, and bovine. |
Rabbit anti CSF-1R (Paired Y723) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope –DTYVEM- without a phosphorylation site at tyrosine 723 of human CSF-1R protein. This sequence is identical within human, mouse, rat, and bovine. |
Rabbit anti CSF-1R Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human CSF-1R protein. This sequence is identical within human, mouse, rat, and bovine. |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody, clone OTI9C1 (formerly 9C1)
| Applications | WB |
| Reactivities | Human, Monkey, Rat, Dog |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Rat
Pathways
- Hematopoietic cell lineage
Filter by
Category
Target Symbol
- MME (36)
- CD36 (20)
- CD4 (19)
- ITGB3 (16)
- CD22 (11)
- CSF1R (10)
- CD9 (7)
- EPOR (7)
- CD2 (6)
- CD44 (6)
- CD1C (5)
- KIT (5)
- TNF (5)
- CD3E (4)
- IL1B (4)
- ANPEP (3)
- BMP2 (3)
- CD19 (3)
- CSF2RA (3)
- EPO (3)
- IL1R1 (3)
- ITGA4 (3)
- ITGAM (3)
- CD33 (2)
- CD34 (2)
- CSF3R (2)
- HLA-DRA (2)
- IL11RA (2)
- IL2RA (2)
- IL7 (2)
- KITLG (2)
- TFRC (2)
- CD1D (1)
- CD38 (1)
- CD3D (1)
- CD3G (1)
- CD5 (1)
- CD55 (1)
- CD59 (1)
- CR1 (1)
- CSF3 (1)
- FCER2 (1)
- FCGR1A (1)
- FLT3 (1)
- GP1BB (1)
- GP9 (1)
- IL1A (1)
- IL1R2 (1)
- IL3 (1)
- IL5 (1)
- IL6R (1)
- IL7R (1)
- ITGA5 (1)
- THPO (1)
- TPO (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (222)
- Transmembrane (212)
- ES Cell Differentiation/IPS (83)
- Adult stem cells (42)
- Protease (41)
- Secreted Protein (37)
- Embryonic stem cells (23)
- Induced pluripotent stem cells (23)
- Protein Kinase (16)
- Cancer stem cells (12)
- Stem cell relevant signaling - DSL/Notch pathway (6)
- Stem cell - Pluripotency (5)
- Transcription Factors (5)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (3)