Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-Tyrosinase Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tyrosinase Antibody: A synthesized peptide derived from human Tyrosinase |
Primary Antibodies
View as table Download
Goat Anti-AOC3 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DEDPSFYSADSIY, from the internal region (near the C Terminus) of the protein sequence according to NP_003725.1. |
Rabbit polyclonal anti-DBH antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DBH. |
Rabbit polyclonal anti-IL4I1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human IL4I1. |
Rabbit polyclonal ADH4 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ADH4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 319-348 amino acids from the C-terminal region of human ADH4. |
Rabbit polyclonal AOC3 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This AOC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 613-640 amino acids from the Central region of human AOC3. |
Rabbit Polyclonal Tyrosine Hydroxylase Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Tyrosine Hydroxylase |
Rabbit Polyclonal Tyrosine Hydroxylase (Ser19) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Tyrosine Hydroxylase around the phosphorylation site of Serine 19 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Tyrosine Hydroxylase (Ser19) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Tyrosine Hydroxylase around the phosphorylation site of Serine 19 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Tyrosine Hydroxylase (Ser31) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Tyrosine Hydroxylase around the phosphorylation site of Serine 31 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Tyrosine Hydroxylase (Ser40) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Tyrosine Hydroxylase around the phosphorylation site of Serine 40 |
| Modifications | Phospho-specific |
Rabbit polyclonal COMT antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COMT. |
Rabbit Polyclonal Anti-LYCAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYCAT antibody: synthetic peptide directed towards the middle region of human LYCAT. Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE |
Rabbit Polyclonal ALDH3B1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal TAT Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO28
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO34
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against GOT2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNLKKEGSTHNWQH, from the internal region of the protein sequence according to NP_002071.2. |
Sheep Anti-Dopamine β-Hydroxylase, C-Terminus, Human Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Primate |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH |
Goat Polyclonal Antibody against thyroid peroxidase
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TRHVIQVSNEVVTDD, from the internal region of the protein sequence according to NP_000538.3; NP_783650.1; NP_783652.1; NP_783653.1. |
Rabbit polyclonal Tyrosine Hydroxylase (Ser31) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 31 (V-T-SP-P-R). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MAOB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV |
Rabbit Polyclonal Anti-MAOB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the C terminal of human MAOB. Synthetic peptide located within the following region: GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA |
Rabbit Polyclonal Anti-ADH4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADH4 Antibody: synthetic peptide directed towards the middle region of human ADH4. Synthetic peptide located within the following region: PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTV |
Rabbit Polyclonal Anti-ADH4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADH4 Antibody: synthetic peptide directed towards the middle region of human ADH4. Synthetic peptide located within the following region: NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET |
Rabbit Polyclonal Anti-HGD
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HGD antibody: synthetic peptide directed towards the middle region of human HGD. Synthetic peptide located within the following region: KLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVL |
Rabbit Polyclonal Anti-ALDH3A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the C terminal of human ALDH3A1. Synthetic peptide located within the following region: KFMNSGQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRI |
Rabbit Polyclonal Anti-ALDH3A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the N terminal of human ALDH3A1. Synthetic peptide located within the following region: DLHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYI |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO35
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against DOPA decarboxylase
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-WEHIKELAADVL, from the C Terminus of the protein sequence according to NP_000781.1. |
Goat Polyclonal Antibody against MAOB
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HKARKLARLTKEE, from the internal region of the protein sequence according to NP_000889.3. |
Goat Polyclonal Antibody against Monoamine Oxidase A
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DAPWEAQHADKWDK, from the internal region of the protein sequence according to NP_000231.1. |
Goat Polyclonal Antibody against ADH1A, B, C
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence STAGKVMKCKA, from the N Terminus of the protein sequence according to NP_000658.1; NP_000659.2; NP_000660.1. |
Goat Polyclonal Antibody against COMT (Internal Region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QDIIPQLKKKYDVD, from the internal region of the protein sequence according to NP_000745.1; NP_009294.1. |
Goat Polyclonal Antibody against GOT1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TADFREDPDPRKVN, from the internal region of the protein sequence according to NP_002070.1. |
Goat Polyclonal Antibody against GOT2 (Internal Region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CKDADEAKRVES, from the internal region of the protein sequence according to NP_002071.2. |
Goat Anti-ADH5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KKIKVDEFVTHN, from the internal region of the protein sequence according to NP_000662.3 . |
Rabbit Polyclonal Aldh3A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Aldh3A1 antibody was raised against a 13 amino acid peptide near the carboxy terminus of the human Aldh3A1. |
Rabbit Polyclonal antibody to FUS2 (N-acetyltransferase 6 (GCN5-related))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 224 and 286 of FUS2 (Uniprot ID#Q93015) |
Sheep Anti-Dopamine β-Hydroxylase, N-Terminus, Human Antibody
| Applications | WB |
| Reactivities | Human, non human primate |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
Sheep Anti-Tyrosine Hydroxylase Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SDS-denatured, native rat tyrosine hydroxylase purified from pheochromocytoma |
Goat Anti-ALDH3B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QDLHKSAFESEVSE, from the internal region of the protein sequence according to NP_000685.1. |
Active filters
Reactivities
- Human
Pathways
- Tyrosine metabolism
Filter by
Category
Target Symbol
- PNMT (87)
- TH (50)
- LCMT1 (45)
- ADH1B (35)
- ADH5 (29)
- ALDH1A3 (20)
- ADH7 (17)
- ALDH3A1 (16)
- TYR (14)
- MAOA (13)
- ALDH3B1 (11)
- GSTZ1 (11)
- GOT2 (8)
- GOT1 (7)
- TAT (7)
- DBH (6)
- PNPLA3 (6)
- TPO (6)
- ADH1A (5)
- ADH4 (5)
- AOX1 (5)
- BUD23 (5)
- DDC (5)
- MAOB (5)
- COMT (4)
- MIF (4)
- DCT (3)
- FAH (3)
- ALDH3B2 (2)
- AOC2 (2)
- AOC3 (2)
- IL4I1 (2)
- LCMT2 (2)
- METTL2B (2)
- NAA80 (2)
- TRMT11 (2)
- TYRP1 (2)
- ADH6 (1)
- HGD (1)
- HPD (1)
- LCLAT1 (1)
- METTL6 (1)
- NAA10 (1)