Rabbit Polyclonal Shc (Tyr427) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Shc around the phosphorylation site of Tyrosine 427 |
| Modifications | Phospho-specific |
Rabbit polyclonal PRKCG (Ab-655) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PRKCG around the phosphorylation site of threonine 655 (A-L-TP-P-P). |
Rabbit Polyclonal Phospho-PKCB (Ser661) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKCB around the phosphorylation site of Serine 661 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PKC alpha (Thr638) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC alpha around the phosphorylation site of Threonine 638 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PKC-pan (Thr497) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC-pan around the phosphorylation site of Threonine 497 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PLCG1 (Tyr771) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 around the phosphorylation site of Tyrosine 771 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PLCG1 (Tyr783) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 around the phosphorylation site of Tyrosine 783 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PKCB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKCB |
Rabbit Polyclonal PLCG2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG2 |
Rabbit Polyclonal PKC alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC alpha |
Rabbit Polyclonal PKC-pan Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC-pan |
Rabbit Polyclonal PLCG1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 |
Rabbit Polyclonal PLCG1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 |
Rabbit Polyclonal Phospho-PLCG2 (Tyr753) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human PLCG2 around the phosphorylation site of Tyrosine 753. |
| Modifications | Phospho-specific |
G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS |
Rabbit Polyclonal Antibody against PRKCB1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This PKC beta2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-673 amino acids from the C-terminal region of human PKC beta2. |
Rabbit polyclonal antibody to Sec61 gamma subunit (Sec61 gamma subunit)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 2 and 66 of Sec61 gamma |
Rabbit polyclonal PKC a (Tyr657) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC a around the phosphorylation site of tyrosine 657 (F-S-YP-V-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal PLCG1 (Tyr771) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PLCG1 around the phosphorylation site of tyrosine 771 (P-D-YP-G-A) |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-PKC beta antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to the C-terminus of mouse PKC β1 |
Anti-PLCG1 (phospho-Tyr771) Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 771 (P-D-Y(p)-G-A) derived from Human PLC-?1. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PDIA4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDIA4 antibody: synthetic peptide directed towards the N terminal of human PDIA4. Synthetic peptide located within the following region: ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL |
Rabbit anti ZO-1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against ARF1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EGLDWLSNQLRNQK, from the C Terminus of the protein sequence according to NP_001019397.1; NP_001649.1; NP_001019398.1; NP_001019399.1. |
Goat Anti-KCNQ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EQLTVPRRGPDEGS, from the C-Terminus of the protein sequence according to NP_000209.2; NP_861463.1. |
Goat Anti-GNAS Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QAARSNSDGEKATK, from the internal region of the protein sequence according to NP_000507.1; NP_001070956.1; NP_001070957.1. |
Goat Anti-ERO1L / ERO1-like (aa105-118) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QSDEVPDGIKSASY, from the internal region of the protein sequence according to NP_055399.1. |
Rabbit Polyclonal TCIRG1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TCIRG1 antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human TCIRG1. |
Anti-ATP6AP1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 90-390 amino acids of human ATPase, H+ transporting, lysosomal accessory protein 1 |
Anti-PLCG1 (Phospho-Tyr783) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 783 (G-F-Y(p)-V-E) derived from Human PLCG1. |
| Modifications | Phospho-specific |
Anti-PLCG1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa. 781~785 (G-F-Y-V-E) derived from Human PLC?1. |
Anti-PLCG2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 300 amino acids of human phospholipase C, gamma 2 (phosphatidylinositol-specific) |
Rabbit Polyclonal Anti-KV7.1 (KCNQ1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)TYEQLTVPRRGPDEGS, corresponding to amino acid residues 661-676 of human Kv7.1. Intracellular, C-terminus. |
Phospho-PLCG2-Y1217 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1217 of human PLCG2 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Atp6v0b Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Atp6v0b Antibody is: synthetic peptide directed towards the N-terminal region of Rat Atp6v0b. Synthetic peptide located within the following region: PSNNLFCPSQPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVG |
Rabbit anti PLC gamma2 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti PLC gamma 1 Polyclonal Antibody
| Reactivities | Human, Rat, Cw |
| Conjugation | Unconjugated |
Rabbit anti ZO-2 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-beta-Actin Antibody (biotin)
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Biotin-Beta-Actin antibody was raised against a synthetic peptide containing 16 amino acids near the amino terminus of beta-actin. |
Rabbit Polyclonal Anti-beta-Actin Antibody (HRP)
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | HRP-Beta-Actin antibody was raised against a synthetic peptide containing 16 amino acids near the amino terminus of beta-actin. |
Mouse Monoclonal Anti-beta-Actin Antibody [10B7]
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-beta-Actin Antibody [10B7] (biotin)
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
