Rabbit Polyclonal Anti-SERPINC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPINC1 antibody: synthetic peptide directed towards the middle region of human SERPINC1. Synthetic peptide located within the following region: ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD |
Rabbit polyclonal SERPINC1 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SERPINC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 364-393 amino acids from the C-terminal region of human SERPINC1. |
Rabbit anti-SERPINC1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SERPINC1 |
Rabbit Polyclonal Anti-Serpinc1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Serpinc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV |
USD 440.00
2 Weeks
Antithrombin III (SERPINC1) goat polyclonal antibody, Serum
| Applications | ELISA, ID, IHC |
| Reactivities | Human |
| Immunogen | Antithrombin III isolated and highly purified from pooled plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit anti SERPINC1/AT3(Antithrombin 3) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the intra domain 160-175aa of human AT3 protein. This sequence is identical to human, mouse, rat, dog, bovine and chicken. |
USD 465.00
4 Weeks
Anti-SERPINC1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 15-259 amino acids of human serpin peptidase inhibitor, clade C (antithrombin), member 1 |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
Germany
Japan
United Kingdom
China
