Primary Antibodies

View as table Download

Rabbit Polyclonal HIF-2 alpha Antibody

Applications IHC, WB
Reactivities Fish, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein.

Rabbit Polyclonal Anti-EPAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPAS1 antibody: synthetic peptide directed towards the middle region of human EPAS1. Synthetic peptide located within the following region: ESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGD

Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody,clone OTI6G3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated