Primary Antibodies

View as table Download

Rabbit anti-PDHA1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PDHA1

Rabbit Polyclonal Anti-PDHA1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDHA1 antibody: synthetic peptide directed towards the N terminal of human PDHA1. Synthetic peptide located within the following region: MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP

Rabbit polyclonal anti-IARS2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IARS2.

Rabbit polyclonal anti-PDHA1 antibody

Applications IHC, WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PDHA1.

Rabbit Polyclonal Anti-PDHA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDHA1 antibody: synthetic peptide directed towards the C terminal of human PDHA1.

Rabbit Polyclonal Anti-PDHB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDHB antibody: synthetic peptide directed towards the N terminal of human PDHB. Synthetic peptide located within the following region: GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAID

Rabbit Polyclonal Anti-BCAT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BCAT1

Rabbit Polyclonal antibody to BCAT2 (branched chain aminotransferase 2, mitochondrial)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 332 of BCAT2 (Uniprot ID#O15382)

Rabbit Polyclonal antibody to LARS2 (leucyl-tRNA synthetase 2, mitochondrial)

Applications IF, IHC, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 204 of LARS2 (Uniprot ID#Q15031)

Rabbit Polyclonal antibody to LARS2 (leucyl-tRNA synthetase 2, mitochondrial)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 181 and 458 of LARS2 (Uniprot ID#Q15031)

Rabbit Polyclonal antibody to Pyruvate Dehydrogenase E1 alpha (pyruvate dehydrogenase (lipoamide) alpha 1)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 39 and 325 of (Uniprot ID#P08559)

BCAT1 mouse monoclonal antibody, clone AT3C8, Purified

Applications ELISA, WB
Reactivities Human

BCAT1 mouse monoclonal antibody, clone AT3C8, Purified

Applications ELISA, WB
Reactivities Human

BCAT1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 88-115 amino acids from the Central region of human BCAT1

BCAT2 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 308-336 amino acids from the C-terminal region of human BCAT2

Leucyl tRNA synthetase (LARS) (N-term) rabbit polyclonal antibody, Purified

Applications FC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 183-213 amino acids from the N-terminal region of Human LARS.

LARS2 (Center) rabbit polyclonal antibody, Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 425-453 amino acids from the Central region of Human LARS2.

PDHA2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 290-318 amino acids from the Central region of Human PDHA2

Rabbit Polyclonal Pyruvate Dehydrogenase E1-alpha subunit [p Ser293] Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding the phosphorylated serine 293 of the human Pyruvate Dehydrogenase E1-alpha subunit protein. [Swiss-Prot #P08559]

Mouse Monoclonal pyruvate dehydrogenase (lipoamide) alpha 1 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

PDHA1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Recombinant Human PDHA1 protein

PDHA1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 233~263 amino acids from the Central region of Human PDHA1

Anti-PDHA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 30-390 amino acids of human pyruvate dehydrogenase (lipoamide) alpha 1

Rabbit Polyclonal Anti-IARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IARS antibody: synthetic peptide directed towards the N terminal of human IARS. Synthetic peptide located within the following region: SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG

Rabbit Polyclonal Anti-IARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IARS antibody: synthetic peptide directed towards the middle region of human IARS. Synthetic peptide located within the following region: YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD

Rabbit Polyclonal Anti-ITPK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITPK1 antibody: synthetic peptide directed towards the middle region of human ITPK1. Synthetic peptide located within the following region: NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI

Rabbit Polyclonal Anti-PDHA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDHA2 Antibody: synthetic peptide directed towards the N terminal of human PDHA2. Synthetic peptide located within the following region: RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG

Rabbit Polyclonal Anti-BCAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCAT1 antibody: synthetic peptide directed towards the N terminal of human BCAT1. Synthetic peptide located within the following region: MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG

Rabbit Polyclonal Anti-VARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS antibody: synthetic peptide directed towards the middle region of human VARS. Synthetic peptide located within the following region: AQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML

Rabbit Polyclonal Anti-VARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS antibody: synthetic peptide directed towards the middle region of human VARS. Synthetic peptide located within the following region: VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP

Rabbit Polyclonal Anti-VARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS2 antibody: synthetic peptide directed towards the middle region of human VARS2. Synthetic peptide located within the following region: LERRFSRVQEVVQVLRALRATYQLTKARPRVLLQSSEPGDQGLFEAFLEP

Carrier-free (BSA/glycerol-free) PDHA1 mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDHA1 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications IHC, WB
Reactivities Human, Mouse, Dog
Conjugation Unconjugated

Rabbit Polyclonal Anti-BCAT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human BCAT2

BCAT2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

IARS2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

PDHA1 mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDHA1 mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDHA1 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PDHA1 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications IHC, WB
Reactivities Human, Mouse, Dog
Conjugation Unconjugated

BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Dog
Conjugation Biotin

BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Dog
Conjugation HRP

BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications IHC, WB
Reactivities Human, Mouse, Dog
Conjugation Unconjugated