Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NR2E3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2E3 antibody: synthetic peptide directed towards the N terminal of human NR2E3. Synthetic peptide located within the following region: METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVC

Rabbit Polyclonal Anti-NR2E3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NR2E3 antibody is: synthetic peptide directed towards the C-terminal region of Human NR2E3. Synthetic peptide located within the following region: EHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELL

NR2E3 / PNR Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen NR2E3 / PNR antibody was raised against synthetic 18 amino acid peptide from near N-terminus of human NR2E3. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset, Mouse, Hamster (94%); Bovine (89%); Elephant, Pig (83%).

NR2E3 / PNR Rabbit Polyclonal (Ligand-binding Domain) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Chimpanzee, Gorilla, Hamster, Horse, Human, Mouse, Pig
Conjugation Unconjugated
Immunogen NR2E3 / PNR antibody was raised against synthetic 19 amino acid peptide from ligand-binding domain of human NR2E3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Mouse, Hamster, Elephant, Panda, Bovine, Bat, Horse, Pig (100%); Marmoset (95%).

Rabbit Polyclonal Anti-NR2E3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NR2E3 antibody is: synthetic peptide directed towards the middle region of Human NR2E3. Synthetic peptide located within the following region: ARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPC

Carrier-free (glycerol/BSA-free) NR2E3 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR2E3 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR2E3 mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) NR2E3 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR2E3 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR2E3 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR2E3 mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR2E3 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) NR2E3 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) NR2E3 mouse monoclonal antibody, clone OTI10C4 (formerly 10C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 121-410 of human NR2E3 (NP_055064.1).
Modifications Unmodified

NR2E3 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

NR2E3 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NR2E3 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

NR2E3 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NR2E3 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI3G3 (formerly 3G3), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

NR2E3 mouse monoclonal antibody, clone OTI3G3 (formerly 3G3), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NR2E3 mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

NR2E3 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NR2E3 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

NR2E3 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NR2E3 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

NR2E3 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NR2E3 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI2H9 (formerly 2H9), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

NR2E3 mouse monoclonal antibody, clone OTI2H9 (formerly 2H9), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NR2E3 mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

NR2E3 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NR2E3 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2E3 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin