Rabbit Polyclonal Anti-SETD7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SETD7 antibody: synthetic peptide directed towards the C terminal of human SETD7. Synthetic peptide located within the following region: PRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF |
Rabbit Polyclonal Set9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Set9 antibody: human Set9 (SET domain containing (lysine methyltransferase) 9), using a recombinant protein. |
Rabbit Polyclonal Set9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Set9 antibody: human Set9 (SET domain containing (lysine methyltransferase) 9), using a recombinant protein. |
Rabbit Polyclonal SETD7/9 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Two synthethic peptides corresponding to amino acids 131-145 (GEVNEDGEMTGEKIA) and 336-352 (GYDHSPPGKSGPEAPEW) of human SETD7 were used as immunogen for this antibody. |
Rabbit Polyclonal Anti-SETD7 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SETD7 |
SETD7 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SETD7 |
SETD7 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-366 of human SETD7 (NP_085151.1). |
| Modifications | Unmodified |
Recombinant Anti-SETD7 (Clone RAB-C220)
| Applications | ChIP, ELISA, FC, IF |
| Reactivities | Human |
| Conjugation | His Tag |
Recombinant Anti-SETD7 (Clone RAB-C220)
| Applications | ChIP, ELISA, FC, IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
