Rabbit Polyclonal Anti-HMGB1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | HMGB1 antibody was raised against a 19 amino acid peptide near the center of human HMGB1. |
Rabbit Polyclonal Anti-HMGB1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | HMGB1 antibody was raised against a 19 amino acid peptide near the center of human HMGB1. |
LIG3 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LIG3 |
Rabbit Polyclonal Antibody against APE1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Affinity purified human Apurinic/Apyrimidinic Endonuclease (APE/ref-1) fusion protein. |
Rabbit Polyclonal NTH1 Antibody
Applications | WB |
Reactivities | Bovine, Human, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the human NTH1 conjugated to KLH. |
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
Applications | IHC, WB |
Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit polyclonal anti-FEN1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FEN1. |
Rabbit polyclonal PCNA Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit Polyclonal UNG1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | UNG1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human UNG1. |
Rabbit Polyclonal UNG1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | UNG1 antibody was raised against a 13 amino acid peptide from near the amino terminus of human UNG1. |
Rabbit anti-FEN1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FEN1 |
Rabbit Polyclonal Anti-PARP2 Antibody
Applications | IF, WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PARP2 antibody: synthetic peptide directed towards the middle region of human PARP2. Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA |
Rabbit polyclonal anti-MUTYH antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MUTYH. |