Rabbit Polyclonal Anti-FBP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBP1 antibody: synthetic peptide directed towards the N terminal of human FBP1. Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA |
Rabbit Polyclonal Anti-PGLS Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGLS antibody: synthetic peptide directed towards the middle region of human PGLS. Synthetic peptide located within the following region: AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL |
Rabbit Polyclonal Anti-RPE Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPE antibody: synthetic peptide directed towards the N terminal of human RPE. Synthetic peptide located within the following region: ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ |
Rabbit Polyclonal Anti-RPE Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPE antibody: synthetic peptide directed towards the middle region of human RPE. Synthetic peptide located within the following region: MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK |
Rabbit Polyclonal Anti-PRPS2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the middle region of human PRPS2. Synthetic peptide located within the following region: VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI |
Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908) |
Rabbit polyclonal Aldolase (ALDOA) Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Aldolase (ALDOA) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 66-95 amino acids from the N-terminal region of human Aldolase (ALDOA). |
Rabbit polyclonal PFKL Antibody (C-term L684)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This PFKL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 669-699 amino acids from the C-terminal region of human PFKL. |
Rabbit Polyclonal Anti-TKTL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TKTL1 Antibody: synthetic peptide directed towards the middle region of human TKTL1. Synthetic peptide located within the following region: QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA |
Rabbit Polyclonal Anti-H6PD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H6PD antibody: synthetic peptide directed towards the N terminal of human H6PD. Synthetic peptide located within the following region: HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW |
Anti-ALDOA rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human aldolase A, fructose-bisphosphate |
Anti-ALDOB Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 109-122 amino acids of human aldolase B, fructose-bisphosphate |
Rabbit Polyclonal Anti-PFKP Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PFKP |
Rabbit Polyclonal Anti-FBP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FBP1 |
Rabbit Polyclonal Anti-FBP2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FBP2 |
Rabbit Polyclonal Anti-TKTL1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TKTL1 |
Rabbit Polyclonal Anti-TKT Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TKT |
Rabbit Polyclonal Anti-PRPS1/2/1L1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PRPS1/2/1L1 |
Germany
Japan
United Kingdom
China
