Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal p53 (Phospho-Ser15) antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal Phospho-p53(T18) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53. |
| Modifications | Phospho-specific |
Rabbit polyclonal p53 (Phospho-Thr387) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of threonine 387 (F-K-TP-E-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-TP53 antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit polyclonal Phospho-p53(S20) Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S20 of human p53. |
| Modifications | Phospho-specific |
p53 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of mouse p53 (NP_035770.2). |
| Modifications | Unmodified |
p53 Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human p53. |
p53 Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human p53. |
Phospho-p53-S33 Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S33 of human p53 (NP_000537.3). |
| Modifications | Phospho S33 |
Phospho-p53-S37 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S37 of human p53. |
| Modifications | Phospho S37 |
Acetyl-p53 (Lys382) Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthesized acetyl-peptide derived from the human p53 around the acetylation site of K382. (Acetylated) |
Phospho-p53 (Ser15) Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human p53 around the phosphorylation site of Ser15. AA range:1-50 (Phosphorylated) |
Recombinant Anti-p53 (Clone PAb421)
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Target Symbol
- TP53
Applications
- IHC
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated
Filter by
Category
Reactivities
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Assay Types
Pathways
- Amyotrophic lateral sclerosis (ALS) (14)
- Apoptosis (14)
- Basal cell carcinoma (14)
- Bladder cancer (14)
- Cell cycle (14)
- Chronic myeloid leukemia (14)
- Colorectal cancer (14)
- Endometrial cancer (14)
- Glioma (14)
- Huntington's disease (14)
- MAPK signaling pathway (14)
- Melanoma (14)
- Neurotrophin signaling pathway (14)
- Non-small cell lung cancer (14)
- Pancreatic cancer (14)
- Pathways in cancer (14)
- Prostate cancer (14)
- Small cell lung cancer (14)
- Thyroid cancer (14)
- Wnt signaling pathway (14)
- p53 signaling pathway (14)