Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ADAMTS1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%). |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit polyclonal antibody to Factor XIIIa (coagulation factor XIII, A1 polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 258 of Factor XIIIa (Uniprot ID#P00488) |
Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
ILEI / FAM3C Rabbit Polyclonal (aa40-80) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chimpanzee, Chicken, Human, Monkey, Mouse, Opossum, Rat, Dog, Pufferfish |
| Conjugation | Unconjugated |
| Immunogen | ILEI / FAM3C antibody was raised against synthetic peptide from human FAM3C. |
Anti-IGFBP-5 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Goat, Hamster, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | IGFBP5 antibody was raised against human IGFBP5 amino acids 192-206 (CRRHMEASLQELKAS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bat, Bovine, Goat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Mouse, Rat, Opossum, Chicken (93%); Marmoset (87%). |
WNT2B Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%). |
Rabbit polyclonal IGFBP2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IGFBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the C-terminal region of human IGFBP2. |
Rabbit Polyclonal antibody to SNTB2 (syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 174 and 540 of SNTB2 (Uniprot ID#Q13425) |
Rabbit Polyclonal antibody to ENTPD6 (ectonucleoside triphosphate diphosphohydrolase 6 (putative function))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 114 and 285 of ENTPD6 |
Rabbit Polyclonal antibody to alpha 2 Antiplasmin (serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 188 and 453 of alpha 2 Antiplasmin (Uniprot ID#P08697) |
Rabbit Polyclonal Wnt-5a Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2. |
Insulin (INS) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Porcine, Rat |
| Conjugation | Unconjugated |
G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS |
Rabbit polyclonal antibody to alpha 2A amylase(pancreatic) (amylase, alpha 2A (pancreatic))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 156 and 430 of alpha amylase 2A (pancreatic) (Uniprot ID#P04746) |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Amphibian, Bovine, Canine, Equine, Opossum |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody. |
WNT6 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%). |
WNT8A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Gorilla, Horse, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | WNT8A antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat, Elephant, Panda, Horse (100%); Bovine, Dog (93%); Rabbit (86%). |
WNT14 / WNT9A Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | WNT14 / WNT9A antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human WNT9A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Mouse, Rat, Bovine, Bat, Rabbit (94%). |
WNT10A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | WNT10A antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Dog, Bovine (100%); Mouse, Rat, Hamster, Bat, Rabbit (94%); Opossum (81%). |
WNT9B Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat |
| Conjugation | Unconjugated |
| Immunogen | WNT9B / WNT15 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT9B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig (100%); Bat, Rabbit (94%); Dog (88%). |
WNT10A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Human, Monkey, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | WNT10A antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Bovine, Bat, Elephant, Panda, Rabbit (100%); Rat, Hamster, Opossum (94%). |
PLA2G3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Gorilla, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%). |
WNT11 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT11 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT11. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus (100%); Opossum, Stickleback (87%); Xenopus, Zebrafish (80%). |
WNT4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | WNT4 antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Pig (100%); Opossum (86%). |
WNT4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | WNT4 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant (94%); Opossum (88%). |
Rabbit Polyclonal Anti-DPP4 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DPP4 / CD26 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human CD26. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey (100%); Gorilla, Marmoset, Bovine (93%); Cat, Rabbit (87%); Dog, Bat, Elephant, Panda, Horse (80%). |
Rabbit Polyclonal Anti-ADAMTS5 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ADAMTS5 antibody was raised against synthetic 16 amino acid peptide from internal region of human ADAMTS5. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Rabbit, Pig (94%); Mouse, Horse, Turkey, Lizard, Xenopus (88%). |
Rabbit Polyclonal Anti-WNT2 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | WNT2 / IRP antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset (100%); Galago, Mouse, Rat, Ferret, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Cat, Bat, Rabbit, Pig, Opossum, Guinea pig, Turkey, Chicken, Armadillo, Platypus (93%); Horse (87%). |
Rabbit Polyclonal Anti-WNT16 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | WNT16 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT16. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Bovine, Horse (93%); Hamster, Elephant, Pig (87%); Mouse, Rat, Panda, Dog, Bat, Rabbit, Lizard (80%). |
Active filters
Reactivities
- Bovine
Applications
- IHC
Antibody Hosts
- Rabbit
Families
- Secreted Protein
Filter by
Category
Target Symbol
- GNAS (3)
- WNT10A (2)
- WNT11 (2)
- WNT4 (2)
- ADAMTS1 (1)
- ADAMTS5 (1)
- ADAMTSL2 (1)
- AGR2 (1)
- AGR3 (1)
- AMPH (1)
- AMY2A (1)
- BMP10 (1)
- DPP4 (1)
- ENTPD6 (1)
- F13A1 (1)
- F9 (1)
- FAM3C (1)
- IGFBP2 (1)
- IGFBP5 (1)
- INHBA (1)
- INS (1)
- LOX (1)
- MUC1 (1)
- PLA2G3 (1)
- PNLIP (1)
- SERPINF2 (1)
- SFN (1)
- SNTB2 (1)
- WNT16 (1)
- WNT2 (1)
- WNT2B (1)
- WNT5A (1)
- WNT6 (1)
- WNT7A (1)
- WNT8A (1)
- WNT9A (1)
- WNT9B (1)
- ZPBP (1)
Isotypes
Clonalities
Conjugates
Pathways
- Melanogenesis (18)
- Basal cell carcinoma (15)
- Hedgehog signaling pathway (15)
- Pathways in cancer (15)
- Wnt signaling pathway (15)
- GnRH signaling pathway (4)
- Long-term depression (4)
- Vascular smooth muscle contraction (4)
- Calcium signaling pathway (3)
- Complement and coagulation cascades (3)
- Dilated cardiomyopathy (3)
- Gap junction (3)
- Metabolic pathways (3)
- Taste transduction (3)
- Vibrio cholerae infection (3)
- Arachidonic acid metabolism (1)
- Cell cycle (1)
- Cytokine-cytokine receptor interaction (1)
- Ether lipid metabolism (1)
- Fc epsilon RI signaling pathway (1)
- Fc gamma R-mediated phagocytosis (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Insulin signaling pathway (1)
- Linoleic acid metabolism (1)
- MAPK signaling pathway (1)
- Maturity onset diabetes of the young (1)
- Oocyte meiosis (1)
- Progesterone-mediated oocyte maturation (1)
- Prostate cancer (1)
- Purine metabolism (1)
- Pyrimidine metabolism (1)
- Regulation of actin cytoskeleton (1)
- Regulation of autophagy (1)
- Starch and sucrose metabolism (1)
- TGF-beta signaling pathway (1)
- Type I diabetes mellitus (1)
- Type II diabetes mellitus (1)
- VEGF signaling pathway (1)
- alpha-Linolenic acid metabolism (1)
- mTOR signaling pathway (1)
- p53 signaling pathway (1)